Microcaecilia unicolor: 115469027 Help Entry 115469027         CDS       T09142                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism muo  Microcaecilia unicolor Pathway muo04010   MAPK signaling pathway muo04012   ErbB signaling pathway muo04068   FoxO signaling pathway muo04137   Mitophagy - animal muo04140   Autophagy - animal muo04144   Endocytosis muo04150   mTOR signaling pathway muo04210   Apoptosis muo04218   Cellular senescence muo04370   VEGF signaling pathway muo04371   Apelin signaling pathway muo04510   Focal adhesion muo04540   Gap junction muo04625   C-type lectin receptor signaling pathway muo04810   Regulation of actin cytoskeleton muo04910   Insulin signaling pathway muo04912   GnRH signaling pathway muo04916   Melanogenesis muo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:muo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115469027 (HRAS)    04012 ErbB signaling pathway     115469027 (HRAS)    04370 VEGF signaling pathway     115469027 (HRAS)    04371 Apelin signaling pathway     115469027 (HRAS)    04068 FoxO signaling pathway     115469027 (HRAS)    04150 mTOR signaling pathway     115469027 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115469027 (HRAS)    04140 Autophagy - animal     115469027 (HRAS)    04137 Mitophagy - animal     115469027 (HRAS)   09143 Cell growth and death    04210 Apoptosis     115469027 (HRAS)    04218 Cellular senescence     115469027 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     115469027 (HRAS)    04540 Gap junction     115469027 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     115469027 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115469027 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     115469027 (HRAS)    04912 GnRH signaling pathway     115469027 (HRAS)    04916 Melanogenesis     115469027 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115469027 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:muo04131]     115469027 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:muo04147]     115469027 (HRAS)    04031 GTP-binding proteins [BR:muo04031]     115469027 (HRAS) Membrane trafficking [BR:muo04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     115469027 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     115469027 (HRAS) Exosome [BR:muo04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115469027 (HRAS)   Exosomal proteins of colorectal cancer cells    115469027 (HRAS) GTP-binding proteins [BR:muo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115469027 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Motif Other DBs NCBI-GeneID:  115469027 NCBI-ProteinID:  XP_030057143 UniProt:  A0A6P7Y2R8 LinkDB All DBs Position 4:complement(223773467..223928339) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PVRTVDTRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGHS CLSCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagctagtggtggtgggagcaggaggtgtggggaagagcgcattaact atacagctcattcagaaccattttgtagatgaatatgacccaacaattgaggactcatac aggaagcaggtggtaattgatggagaaacctgtttgttagatattctggacacagctggc caggaagaatacagtgcaatgagagaccagtacatgcgcactggggaaggattcctttgc gtctttgctattaacaacaccaagtcctttgaagacattcaccagtatcgtgagcaaata aaacgggtgaaggactcggatgatgtgcctatggtgttagtggggaacaagtgtgatttg ccagtgcgaacagtagacacacggcaggcacaggaccttgccaggagttatgggatccca tacatagagacatcagcaaagaccagacagggagttgaagatgccttctacacattagtc cgagagatccgtcagcacaaattgcgcaaattgaatcccccagatgaaagtggtcacagc tgtctaagctgtaaatgtgtgatatcatga

DBGET integrated database retrieval system