Microcaecilia unicolor: 115471578 Help Entry 115471578         CDS       T09142                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism muo  Microcaecilia unicolor Pathway muo04137   Mitophagy - animal muo04140   Autophagy - animal muo04144   Endocytosis muo04145   Phagosome muo04148   Efferocytosis muo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:muo00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115471578 (RAB7A)    04145 Phagosome     115471578 (RAB7A)    04140 Autophagy - animal     115471578 (RAB7A)    04137 Mitophagy - animal     115471578 (RAB7A)    04148 Efferocytosis     115471578 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115471578 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:muo04131]     115471578 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:muo04147]     115471578 (RAB7A)    04031 GTP-binding proteins [BR:muo04031]     115471578 (RAB7A) Membrane trafficking [BR:muo04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     115471578 (RAB7A) Exosome [BR:muo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115471578 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    115471578 (RAB7A)   Exosomal proteins of colorectal cancer cells    115471578 (RAB7A)   Exosomal proteins of bladder cancer cells    115471578 (RAB7A) GTP-binding proteins [BR:muo04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     115471578 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NB-ARC NACHT AAA_14 SRPRB ABC_tran ATP-synt_ab DAP3 Motif Other DBs NCBI-GeneID:  115471578 NCBI-ProteinID:  XP_030061108 UniProt:  A0A6P7YE61 LinkDB All DBs Position 6:138008234..138086101 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCNSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRARASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctgcttaaagtcatcatcctaggagattcaggggtagga aaaacttcacttatgaatcaatatgtaaacaagaaattcagtaatcagtataaagcgaca ataggagccgacttcctaacgaaggaagtgatggtggatgacaggctggtcacaatgcag atatgggacacagcaggacaagaacggtttcagtctctgggggtagcgttctacagaggg gcagactgctgcgtcctggtattcgatgtgactgcacccaacacctttaaaacgcttgac agctggagggatgagtttcttattcaggccagtccaagagatcctgaaaatttcccgttt gttgtcctgggaaacaagatagaccttgaaaacagacaagttactacaaagcgagcgcag gcatggtgcaacagcaaaaacaacatcccatattttgaaacgagtgccaaggaggcaatt aacgttgaacaggctttccaaaccattgcacgaaatgcacttaaacaggaaacagaggtg gagctgtacaatgaattccctgaacccatcaaactagacaagaatgaccgagcaagggcc tcggcagagagctgtagttgctga

DBGET integrated database retrieval system