Microcaecilia unicolor: 115472793 Help Entry 115472793         CDS       T09142                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism muo  Microcaecilia unicolor Pathway muo04810   Regulation of actin cytoskeleton muo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:muo00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     115472793 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115472793 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd SPX DUF7310 Matrilin_ccoil LXG MerR-DNA-bind DUF5617 Motif Other DBs NCBI-GeneID:  115472793 NCBI-ProteinID:  XP_030063088 UniProt:  A0A6P7YDG8 LinkDB All DBs Position 6:complement(190098855..190100739) Genome browser AA seq 75 aa AA seqDB search MASSEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccagctcggaggatccggtacaacgcgagatccaccaggattgggcgaaccgcgag tatattgaggtgatcaccagtagcattaagaagatcgccgacttcctcaactctttcgac atgtcgtgtcgatcccggctggcgactctcaatgaaaagctgacagccttagaaagaaga attgagtacatagaggccagggtaacaaaaggtgagactctcacataa

DBGET integrated database retrieval system