Microcaecilia unicolor: 115481232 Help Entry 115481232         CDS       T09142                                  Name (RefSeq) neo-calmodulin-like   KO K02183   calmodulin Organism muo  Microcaecilia unicolor Pathway muo04020   Calcium signaling pathway muo04070   Phosphatidylinositol signaling system muo04114   Oocyte meiosis muo04218   Cellular senescence muo04261   Adrenergic signaling in cardiomyocytes muo04270   Vascular smooth muscle contraction muo04371   Apelin signaling pathway muo04625   C-type lectin receptor signaling pathway muo04744   Phototransduction muo04910   Insulin signaling pathway muo04912   GnRH signaling pathway muo04916   Melanogenesis Brite KEGG Orthology (KO) [BR:muo00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     115481232    04020 Calcium signaling pathway     115481232    04070 Phosphatidylinositol signaling system     115481232  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     115481232    04218 Cellular senescence     115481232  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115481232   09152 Endocrine system    04910 Insulin signaling pathway     115481232    04912 GnRH signaling pathway     115481232    04916 Melanogenesis     115481232   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     115481232    04270 Vascular smooth muscle contraction     115481232   09157 Sensory system    04744 Phototransduction     115481232  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:muo01009]     115481232   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:muo04131]     115481232    03036 Chromosome and associated proteins [BR:muo03036]     115481232   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:muo04147]     115481232 Protein phosphatases and associated proteins [BR:muo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      115481232 Membrane trafficking [BR:muo04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     115481232 Chromosome and associated proteins [BR:muo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      115481232 Exosome [BR:muo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    115481232 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 SPARC_Ca_bdg EH EF-hand_EFHB_C EF_EFCAB10_C Dockerin_1 SAPC2_N EF-hand_11 DUF5580_M UPF0154 SPEF2_C EFhand_Ca_insen Caleosin EF-hand_SWAP70_N RNA_pol_Rpb4 MotA_activ RFC1 YqeY Motif Other DBs NCBI-GeneID:  115481232 NCBI-ProteinID:  XP_030076198 UniProt:  A0A6P7ZEH1 LinkDB All DBs Position 11:complement(111822358..111856428) Genome browser AA seq 156 aa AA seqDB search MDRQHLNQEDQLTKEQILEIKEAFSLFDKNGDGTVSIKEVGTVMRSLGQNPTEAELQELI NLADAEGNGTINFPEFLTLMASKMKNTNCEEEIREAFRVFDKDNNGFISAAELRHIMTNL GEKLTEEEVNEMIQEADVDQNGQVNYEEFVQMMTAK NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggacaggcaacatcttaatcaggaggatcaactgacaaaggagcaaattctagagatt aaagaagcattttcactatttgataagaatggtgatggcactgtcagcatcaaggaggtg gggactgtgatgcgatcactgggccagaaccccactgaggcagagctgcaagagctgatt aacttggctgatgctgagggcaatggcaccatcaacttccccgagttcctcaccctaatg gcaagcaagatgaagaacacaaactgtgaggaggagatccgtgaggccttccgagtgttt gacaaagataataatggtttcatcagtgcagctgaactgcgtcatattatgaccaacctt ggcgagaagctgacggaagaggaagtgaatgagatgatccaggaggcagatgtggaccaa aatgggcaggtcaactatgaagaatttgtacaaatgatgactgccaaatag

DBGET integrated database retrieval system