Microcaecilia unicolor: 115481569 Help Entry 115481569         CDS       T09142                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism muo  Microcaecilia unicolor Pathway muo04010   MAPK signaling pathway muo04012   ErbB signaling pathway muo04068   FoxO signaling pathway muo04137   Mitophagy - animal muo04140   Autophagy - animal muo04150   mTOR signaling pathway muo04210   Apoptosis muo04218   Cellular senescence muo04370   VEGF signaling pathway muo04371   Apelin signaling pathway muo04540   Gap junction muo04625   C-type lectin receptor signaling pathway muo04810   Regulation of actin cytoskeleton muo04910   Insulin signaling pathway muo04912   GnRH signaling pathway muo04916   Melanogenesis Brite KEGG Orthology (KO) [BR:muo00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     115481569 (NRAS)    04150 mTOR signaling pathway     115481569 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115481569 (NRAS)    04137 Mitophagy - animal     115481569 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:muo04131]     115481569 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:muo04147]     115481569 (NRAS)    04031 GTP-binding proteins [BR:muo04031]     115481569 (NRAS) Membrane trafficking [BR:muo04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     115481569 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     115481569 (NRAS) Exosome [BR:muo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115481569 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    115481569 (NRAS)   Exosomal proteins of breast cancer cells    115481569 (NRAS)   Exosomal proteins of colorectal cancer cells    115481569 (NRAS) GTP-binding proteins [BR:muo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115481569 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin ParA Ldh_1_N Motif Other DBs NCBI-GeneID:  115481569 NCBI-ProteinID:  XP_030076674 UniProt:  A0A6P7ZS68 LinkDB All DBs Position 12:complement(15761649..15790783) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTKQAQEVAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDSNQG CNGLSCTLV NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtataaactggtggtggtcggagctggaggtgttgggaagagcgcactgaca atccaactaatacagaaccactttgtggacgagtatgaccccacgatagaggactcgtac cggaagcaagtggtgatagacggcgagacgtgccttttggacattctggacacggctggg caggaggagtacagcgccatgcgggatcagtacatgcgaacaggtgaaggcttcctttgc gtcttcgctatcaacaacagcaagtcgtttgccgacatcaatctctacagggagcaaatt aaaagggtgaaagactctgatgatgtgccgatggtgctggtggggaacaaatgcgacctg cccagcaggactgtggacacaaagcaagctcaggaggtcgccaagagctatgggatacct ttcattgaaacgtctgccaaaacgagacaaggagtcgaggatgccttttacacgctggtc agagaaatccggcagtacagaatgaaaaaactgaacagcagtgaggacagtaatcagggc tgcaatggcctctcatgcacactcgtgtga

DBGET integrated database retrieval system