KEGG   Musa acuminata (dessert banana): 103985461
Entry
103985461         CDS       T03447                                 
Name
(RefSeq) SKP1-like protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
mus  Musa acuminata (dessert banana)
Pathway
mus03083  Polycomb repressive complex
mus04120  Ubiquitin mediated proteolysis
mus04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mus00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103985461
   04120 Ubiquitin mediated proteolysis
    103985461
  09126 Chromosome
   03083 Polycomb repressive complex
    103985461
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mus04131]
    103985461
   04121 Ubiquitin system [BR:mus04121]
    103985461
   03036 Chromosome and associated proteins [BR:mus03036]
    103985461
Membrane trafficking [BR:mus04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    103985461
Ubiquitin system [BR:mus04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     103985461
   Cul7 complex
     103985461
Chromosome and associated proteins [BR:mus03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     103985461
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     103985461
SSDB
Motif
Pfam: Skp1 Skp1_POZ Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103985461
NCBI-ProteinID: XP_009401439
UniProt: A0A804HRP0
LinkDB
Position
BXJ2-1:complement(3592641..3597521)
AA seq 157 aa
MEKKITLRSSDGEVFEVDVAVAMESQTIKHMIEDDCAENGIPLPNVNAKILAKVIEYCRK
HVDAAASKSSDDASKVDEELKPWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVAD
MIKGKTPEEIRKTFNIKNDFTPEEEDEVRRENQWAFE
NT seq 474 nt   +upstreamnt  +downstreamnt
atggagaagaagatcaccctcaggagctccgacggcgaggtgttcgaggtggatgtggcg
gtggcgatggagtcgcagaccatcaagcacatgatcgaggacgactgcgccgagaacggg
attcccctccccaatgtcaacgccaagatcctcgccaaggtcatcgagtactgcaggaag
cacgtcgatgccgccgcttccaagtcctccgacgacgcttccaaggttgatgaggagctc
aagccctgggacgccgagttcgtcaaggtcgatcaggccaccctattcgacctcattctg
gctgcaaattatctgaacataaaggggctacttgacttgacttgtcaaactgtcgccgac
atgataaaggggaagactcctgaagaaatccgcaagaccttcaacataaaaaatgacttc
acccccgaggaggaagacgaggtgcggagggagaaccagtgggccttcgagtga

DBGET integrated database retrieval system