Musa acuminata (dessert banana): 135604893 Help Entry 135604893         CDS       T03447                                  Name (RefSeq) calcium-binding protein CP1-like   KO K02183   calmodulin Organism mus  Musa acuminata (dessert banana) Pathway mus04016   MAPK signaling pathway - plant mus04070   Phosphatidylinositol signaling system mus04075   Plant hormone signal transduction mus04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:mus00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     135604893    04070 Phosphatidylinositol signaling system     135604893    04075 Plant hormone signal transduction     135604893  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     135604893  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mus01009]     135604893   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mus04131]     135604893    03036 Chromosome and associated proteins [BR:mus03036]     135604893   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mus04147]     135604893 Protein phosphatases and associated proteins [BR:mus01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      135604893 Membrane trafficking [BR:mus04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     135604893 Chromosome and associated proteins [BR:mus03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      135604893 Exosome [BR:mus04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    135604893 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 EH Motif Other DBs NCBI-GeneID:  135604893 NCBI-ProteinID:  XP_064950616 LinkDB All DBs Position BXJ2-2:4469713..4470422 Genome browser AA seq 149 aa AA seqDB search MCPAGRGLAPAPLRPAFDVLDADRDGKISQDDLKAFFSSGVAAALSDEDIGSMISAADAD RDGLVEFEEFERVLGRPRGGDGVMAEAFRVMDRDGDGKVGFGDLKAYLKMAGLPASDDDI WTMIRMGGSDGISFDALVKILAVDLANGP NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgtgccccgccggccgcggcctagccccggcccccctccggccggcgttcgacgtcctc gacgccgaccgcgacggcaagataagccaagacgacctcaaggccttcttctcttccggc gtcgccgcggccctctcggacgaggacatcggttccatgatctccgccgccgacgccgac cgcgacgggctcgtggagttcgaggagttcgagcgcgtccttggccgcccccgcggcggg gacggcgtcatggcggaggcgttccgcgtgatggatcgtgatggggacgggaaggtgggg ttcggggacctgaaggcgtacctgaagatggctgggctgccggccagcgacgatgatatc tggacgatgatacggatgggcggcagcgatgggattagctttgacgccctcgtcaagatc ctcgccgtcgatctcgccaatggcccgtga

DBGET integrated database retrieval system