Musa acuminata (dessert banana): 135609552 Help Entry 135609552         CDS       T03447                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mus  Musa acuminata (dessert banana) Pathway mus04145   Phagosome mus04148   Efferocytosis mus04517   IgSF CAM signaling mus04518   Integrin signaling mus04620   Toll-like receptor signaling pathway mus05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mus00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     135609552    04518 Integrin signaling     135609552  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     135609552    04148 Efferocytosis     135609552  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     135609552  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     135609552  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mus04131]     135609552   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mus04147]     135609552    04031 GTP-binding proteins [BR:mus04031]     135609552 Membrane trafficking [BR:mus04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     135609552  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     135609552   Macropinocytosis    Ras GTPases     135609552  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     135609552 Exosome [BR:mus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135609552   Exosomal proteins of other body fluids (saliva and urine)    135609552   Exosomal proteins of colorectal cancer cells    135609552   Exosomal proteins of bladder cancer cells    135609552 GTP-binding proteins [BR:mus04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     135609552 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  135609552 NCBI-ProteinID:  XP_064959001 LinkDB All DBs Position BXJ2-4:3764554..3769148 Genome browser AA seq 197 aa AA seqDB search MSASSFVKCVTVGDGAVGKTCMLISYTSNTFPTDYIPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKGSYENVSKKWIPELRHYAPGVPIILVGTKL DLRDDEQFFIDHPGSTSITNAQGEELRKQIGAPCYIECSSKTQENIKPVFDAAIKVALQP SNRKKKKKKAQKGCFIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtcgagctttgtaaagtgcgtcacggtgggcgacggggccgtcggcaagacc tgcatgcttatttcgtacaccagcaatactttccccacggattatattccaactgtcttt gacaatttcagtgcaaatgttgtggttgatggtaacacagttaacttgggcttgtgggat actgcaggccaggaggattacaatagattaagacctttgagctaccgaggtgcagatgtt tttcttctggcattctctcttataagtaaaggaagctatgagaatgtatctaagaagtgg attcctgaattaagacattatgcacctggtgtgcctataattcttgttggaacaaagctt gatctacgggatgatgagcagtttttcatagatcaccctggttcgacttccattactaac gctcaaggcgaggagctgaggaagcaaatcggtgctccttgctacatcgagtgcagttca aagacccaagaaaacattaagccagtgttcgacgcagctattaaggtggcacttcagccg tcgaatcgaaagaaaaagaagaagaaagcacagaagggatgcttcatcttgtga

DBGET integrated database retrieval system