Musa acuminata (dessert banana): 135615325 Help Entry 135615325         CDS       T03447                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism mus  Musa acuminata (dessert banana) Pathway mus04016   MAPK signaling pathway - plant mus04070   Phosphatidylinositol signaling system mus04075   Plant hormone signal transduction mus04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:mus00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     135615325    04070 Phosphatidylinositol signaling system     135615325    04075 Plant hormone signal transduction     135615325  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     135615325  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mus01009]     135615325   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mus04131]     135615325    03036 Chromosome and associated proteins [BR:mus03036]     135615325   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mus04147]     135615325 Protein phosphatases and associated proteins [BR:mus01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      135615325 Membrane trafficking [BR:mus04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     135615325 Chromosome and associated proteins [BR:mus03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      135615325 Exosome [BR:mus04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    135615325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin FCaBP_EF-hand MotA_activ SPEF2_C SurA_N_3 PA_Ig-like DUF6279 Fe_hyd_lg_C PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  135615325 NCBI-ProteinID:  XP_064969707 LinkDB All DBs Position BXJ2-6:33968217..33977210 Genome browser AA seq 149 aa AA seqDB search MAEQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggagcagctcaccgacgagcagatctccgagttcaaggaggcattcagcttgttc gacaaggatggcgatggttgcatcacaaccaaggagttgggaaccgtgatgcgttctctg ggtcagaaccccacggaggctgagctgcaggacatgataaatgaggttgatgcagatggc aatgggacaattgacttcccggagttcctcaacctgatggcacgcaagatgaaggatacc gactcagaggaggagctgaaggaggcctttcgggtatttgacaaggatcagaatggcttc atctctgccgctgagctccgccatgtcatgaccaaccttggcgagaagttgacggatgag gaggtcgacgagatgattcgagaggctgatgttgacggtgatggccagatcaactacgag gaattcgttaaagtcatgatggccaagtga

DBGET integrated database retrieval system