Musa acuminata (dessert banana): 135616648 Help Entry 135616648         CDS       T03447                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mus  Musa acuminata (dessert banana) Pathway mus04145   Phagosome mus04148   Efferocytosis mus04517   IgSF CAM signaling mus04518   Integrin signaling mus04620   Toll-like receptor signaling pathway mus05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mus00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     135616648    04518 Integrin signaling     135616648  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     135616648    04148 Efferocytosis     135616648  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     135616648  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     135616648  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mus04131]     135616648   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mus04147]     135616648    04031 GTP-binding proteins [BR:mus04031]     135616648 Membrane trafficking [BR:mus04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     135616648  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     135616648   Macropinocytosis    Ras GTPases     135616648  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     135616648 Exosome [BR:mus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135616648   Exosomal proteins of other body fluids (saliva and urine)    135616648   Exosomal proteins of colorectal cancer cells    135616648   Exosomal proteins of bladder cancer cells    135616648 GTP-binding proteins [BR:mus04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     135616648 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf AAA_7 Motif Other DBs NCBI-GeneID:  135616648 NCBI-ProteinID:  XP_064972120 LinkDB All DBs Position BXJ2-7:3110932..3114542 Genome browser AA seq 195 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNIGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELNHYAPGVPIILVGTKL DLRDDKQFFMDHPGAVSVSAAQGEELRKLIGAPSYIECSSKTQQNIKAVFDAAIKVVLQP PKKKGRKAQKGCSIL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgagtgcctccaggtttatcaagtgcgtcacggtgggcgacggcgccgtcggcaagacc tgcatgctcatatcgtacaccagcaacactttcccaacggattatgtccctacggtgttt gacaatttcagtgcaaatgtagtggttgatggtaacacggttaatataggtttgtgggat actgcaggccaagaagattacaacagactaagacctttgagctatcgaggtgcagatgtt tttctgttagccttctctctcataagtaaagccagctatgaaaatgtggccaagaagtgg attcctgaactgaatcactatgcacctggagtgcccataattctcgtcggaacaaaactt gatctccgggatgataagcagtttttcatggatcaccctggtgccgtatctgtaagtgct gctcagggggaagaattgaggaagctaatcggtgctccttcctacatcgagtgcagttca aagacacagcaaaatataaaggcagtatttgatgcggccattaaagtggtactccaacca cccaaaaagaaaggtaggaaggcgcagaagggttgctccatcttgtga

DBGET integrated database retrieval system