Musa acuminata (dessert banana): 135616648 Help Entry 135616648         CDS       T03447                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mus  Musa acuminata (dessert banana) Pathway mus04145   Phagosome mus04148   Efferocytosis mus04620   Toll-like receptor signaling pathway mus05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mus00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     135616648    04148 Efferocytosis     135616648  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     135616648  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     135616648  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mus04131]     135616648   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mus04147]     135616648    04031 GTP-binding proteins [BR:mus04031]     135616648 Membrane trafficking [BR:mus04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     135616648  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     135616648   Macropinocytosis    Ras GTPases     135616648  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     135616648 Exosome [BR:mus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135616648   Exosomal proteins of other body fluids (saliva and urine)    135616648   Exosomal proteins of colorectal cancer cells    135616648   Exosomal proteins of bladder cancer cells    135616648 GTP-binding proteins [BR:mus04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     135616648 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf AAA_7 Motif Other DBs NCBI-GeneID:  135616648 NCBI-ProteinID:  XP_064972120 LinkDB All DBs Position BXJ2-7:3110932..3114542 Genome browser AA seq 195 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNIGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELNHYAPGVPIILVGTKL DLRDDKQFFMDHPGAVSVSAAQGEELRKLIGAPSYIECSSKTQQNIKAVFDAAIKVVLQP PKKKGRKAQKGCSIL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgagtgcctccaggtttatcaagtgcgtcacggtgggcgacggcgccgtcggcaagacc tgcatgctcatatcgtacaccagcaacactttcccaacggattatgtccctacggtgttt gacaatttcagtgcaaatgtagtggttgatggtaacacggttaatataggtttgtgggat actgcaggccaagaagattacaacagactaagacctttgagctatcgaggtgcagatgtt tttctgttagccttctctctcataagtaaagccagctatgaaaatgtggccaagaagtgg attcctgaactgaatcactatgcacctggagtgcccataattctcgtcggaacaaaactt gatctccgggatgataagcagtttttcatggatcaccctggtgccgtatctgtaagtgct gctcagggggaagaattgaggaagctaatcggtgctccttcctacatcgagtgcagttca aagacacagcaaaatataaaggcagtatttgatgcggccattaaagtggtactccaacca cccaaaaagaaaggtaggaaggcgcagaagggttgctccatcttgtga

DBGET integrated database retrieval system