Musa acuminata (dessert banana): 135617701 Help Entry 135617701         CDS       T03447                                  Name (RefSeq) calmodulin-3-like   KO K02183   calmodulin Organism mus  Musa acuminata (dessert banana) Pathway mus04016   MAPK signaling pathway - plant mus04070   Phosphatidylinositol signaling system mus04075   Plant hormone signal transduction mus04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:mus00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     135617701    04070 Phosphatidylinositol signaling system     135617701    04075 Plant hormone signal transduction     135617701  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     135617701  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mus01009]     135617701   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mus04131]     135617701    03036 Chromosome and associated proteins [BR:mus03036]     135617701   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mus04147]     135617701 Protein phosphatases and associated proteins [BR:mus01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      135617701 Membrane trafficking [BR:mus04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     135617701 Chromosome and associated proteins [BR:mus03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      135617701 Exosome [BR:mus04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    135617701 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen RNA_pol_Rpb4 Dockerin_1 Caleosin MotA_activ SPEF2_C FCaBP_EF-hand SurA_N_3 DUF6279 Fe_hyd_lg_C PA_Ig-like MecA_N Motif Other DBs NCBI-GeneID:  135617701 NCBI-ProteinID:  XP_064974264 LinkDB All DBs Position BXJ2-7:33718468..33722007 Genome browser AA seq 149 aa AA seqDB search MAEQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELREAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggagcagttgacggacgaccagatcgcggagttcaaggaggccttcagcctcttc gacaaggatggagacggttgcatcacgaccaaggagcttggaactgtgatgcgatcactg ggacagaatcctacagaggcagagctacaggacatgatcaatgaggttgatgcagatggt aatggaactattgattttccagagttcttaaatctgatggcacgcaagatgaaggacacc gactcagaggaggaacttagggaggctttccgagtgtttgacaaggatcagaatgggttc atctcagcagctgagcttcgtcatgtcatgaccaatctcggagagaagctgactgatgag gaggttgatgagatgattcgtgaagctgatgttgatggtgatggtcagatcaactatgac gagtttgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system