Musa acuminata (dessert banana): 135623421 Help Entry 135623421         CDS       T03447                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mus  Musa acuminata (dessert banana) Pathway mus04145   Phagosome mus04148   Efferocytosis mus04620   Toll-like receptor signaling pathway mus05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mus00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     135623421    04148 Efferocytosis     135623421  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     135623421  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     135623421  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mus04131]     135623421   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mus04147]     135623421    04031 GTP-binding proteins [BR:mus04031]     135623421 Membrane trafficking [BR:mus04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     135623421  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     135623421   Macropinocytosis    Ras GTPases     135623421  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     135623421 Exosome [BR:mus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135623421   Exosomal proteins of other body fluids (saliva and urine)    135623421   Exosomal proteins of colorectal cancer cells    135623421   Exosomal proteins of bladder cancer cells    135623421 GTP-binding proteins [BR:mus04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     135623421 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  135623421 NCBI-ProteinID:  XP_064982450 LinkDB All DBs Position BXJ2-9:39628969..39641334 Genome browser AA seq 196 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDEQQFFIDHPGAVPISTAQGEELRKQIGAASYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKQQKGCSIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtcgaggtttataaagtgcgtcacggtgggggacggtgccgtcggcaagact tgcatgcttatctcctacaccagcaacactttccccacggattatgttcctaccgttttt gacaatttcagcgcaaatgtagtggtggatggtaacacagttaacttaggtttgtgggat actgcaggccaagaggattacaatagattaagacctttgagctaccgtggtgcagatgtt ttcttgcttgctttctctctcattagtaaagccagctatgaaaatgttgccaagaagtgg attcctgagctaaggcactatgcacctggtgtgcccataattcttgttggaacaaagctt gatcttcgggatgagcagcagttctttatagatcacccaggtgctgttcccataagtacc gctcagggggaggagctgcggaagcaaataggtgctgcttcgtacatagagtgcagttca aagactcagcaaaatgtcaaggcggtattcgatgcggccatcaaggtcgtgcttcagcca cccaagcagaagaagaaaaaaaagcaacagaaaggttgctccatattgtga

DBGET integrated database retrieval system