KEGG   Mycolicibacterium vanbaalenii: Mvan_0488
Entry
Mvan_0488         CDS       T00449                                 
Name
(GenBank) ring hydroxylating dioxygenase, alpha subunit
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00624  Polycyclic aromatic hydrocarbon degradation
mva01100  Metabolic pathways
mva01120  Microbial metabolism in diverse environments
mva01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mvan_0488
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     Mvan_0488
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABM11333
UniProt: A1T2D3
LinkDB
Position
530959..532326
AA seq 455 aa
MTTETTGTADATDPYLRRALREVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVFLGH
ESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHRGALVCRAEMGNTAHFQCPYH
GWVYSNTGELVGVPAMSEAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTDYLG
DTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELGMAP
GDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMATSYPSPVHKDLMR
RSSFIHGTVFPNLSFINVTLAQDHMSPPTPFITFRVWHPLSHDRMEVLSWFLVERDAPEW
LRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGEGLLNYEMGMDLTPLTDWPG
PGEALPSGYAEQNQRRFWGRWLEYMGQPPAFGGRA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccggaacagctgacgcgaccgatccctacctgcggcgcgcgttg
cgggaggtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtcagcgatccc
gcgctacacacgatcgagatggagcggatcttcgggcgcgcctgggtgtttctcggacac
gagtcggagttggccaagtccggcgacttcgtcgtgcggcacatcggggccgattcggtg
atcgtttgccgggacaactccggccgcatccaggcgctgtccaattcttgtcgccaccgt
ggtgcgctcgtgtgccgcgctgagatgggaaacaccgcgcacttccaatgcccgtaccac
ggctgggtgtacagcaacaccggagagctcgtcggcgtgccggcgatgagtgaggcctat
cccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtcgactcgtac
gccggattcatcttcggcagcgtcgatccgaaggcgccgagcctgaccgactacctcggc
gacacgacgttctacctcgacctcattgcgaagaagacagcgggcggtctggaggtgata
ggggcaccgcatcgatgggtgatgtcagcgaactggaagacagccgccgacaattttgtc
ggcgactcctaccacaccctctttgctcaccgctcgatggtcgagctaggcatggcgccc
ggtgacccaaacttcgcgagcgcaccagcggagatctcgctgcagaacggccacggcgtc
ggcgtactcggctttccgcccacgctcgccgattttcccgagtacgagggataccccgac
gaagtcgtcgaccagatggcgacgtcctacccgtcgccggtacacaaggacctgatgcga
cgctcatcctttattcacggcaccgtgttcccgaatttgtcgttcatcaacgtgaccctc
gcgcaggaccacatgtcgccccctacccccttcatcacgttccgggtatggcatccgctc
tcccatgatcggatggaggtcctctcctggttcctggtcgaacgcgatgctccggaatgg
ttgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccaggtggggttttcgaa
caggacgacgccgaggcatggaaggccatcaccgaatctgtgcagggcccgttcgccggt
gaaggcctgctgaactacgaaatgggcatggacttgactccgctcaccgactggccaggg
ccgggagaggccctcccgagcgggtacgccgagcagaatcagcggcggttttgggggaga
tggctggaatacatgggtcagcctcccgcattcggcgggcgtgcttga

DBGET integrated database retrieval system