Microbulbifer variabilis: MJO52_12660 Help Entry MJO52_12660       CDS       T08656                                  Name (GenBank) hypothetical protein   KO K03503   DNA polymerase V [EC:3.4.21.-] Organism mvb  Microbulbifer variabilis Brite KEGG Orthology (KO) [BR:mvb00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mvb01002]     MJO52_12660   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mvb03400]     MJO52_12660 Peptidases and inhibitors [BR:mvb01002]  Serine peptidases   Family S24: LexA family    MJO52_12660 DNA repair and recombination proteins [BR:mvb03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Y-family DNA polymerases     MJO52_12660 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_S24 Motif Other DBs NCBI-ProteinID:  USD19929 UniProt:  A0ABY4VD79 LinkDB All DBs Position complement(2838506..2838748) Genome browser AA seq 80 aa AA seqDB search MKLTPLYGSGVSCGFPSPADDYKEEALSLDDHLITSGPTTFMARANGDSMQGVGIFDRDI LIIPGESRRFSILAPYVLLC NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgaaacttacccctctatacggcagcggcgtcagctgcggcttcccctcaccggcagac gactacaaagaagaagccctcagtctagatgatcatttaataaccagcggcccgacgacg ttcatggctcgtgccaatggcgactctatgcaaggggtgggaatcttcgaccgggacatt cttatcattcccggagagagcaggagattcagtatcctggccccgtatgtcctcctttgc tag

DBGET integrated database retrieval system