Methanosarcina vacuolata: MSVAZ_3249 Help Entry MSVAZ_3249        CDS       T03815                                  Name (GenBank) LSU ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mvc  Methanosarcina vacuolata Pathway mvc03010   Ribosome Brite KEGG Orthology (KO) [BR:mvc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSVAZ_3249   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSVAZ_3249  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mvc03011]     MSVAZ_3249    04121 Ubiquitin system [BR:mvc04121]     MSVAZ_3249 Ribosome [BR:mvc03011]  Ribosomal proteins   Eukaryotes    Large subunit     MSVAZ_3249   Archaea     MSVAZ_3249 Ubiquitin system [BR:mvc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSVAZ_3249 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 zf-AtTam37 Zn_ribbon_RPAB4 Zn_ribbon_ZPR1 Cas12f1-like_TNB Ribosomal_L37e zf-ChsH2 Zn_ribbon_LapB Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  AKB45518 UniProt:  A0A0E3Q9A4 LinkDB All DBs Position complement(4181477..4181626) Genome browser AA seq 49 aa AA seqDB search MGRFPEAEERLLNKKICMRCNARNAIRATRCRKCGYSALRVKSKESKGA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgggtcgttttccagaagcagaagaaagattattaaataaaaaaatttgcatgcgatgc aatgcaaggaatgcaataagggcaacccgctgcagaaaatgcggctacagtgctcttcgg gtaaaatccaaggaatccaagggagcatga

DBGET integrated database retrieval system