Mycoplasmopsis verecunda: SAM46_00635 Help Entry SAM46_00635       CDS       T09525                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mver  Mycoplasmopsis verecunda Pathway mver01100   Metabolic pathways mver01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mver00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SAM46_00635    00074 Mycolic acid biosynthesis     SAM46_00635   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SAM46_00635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WPB54656 LinkDB All DBs Position 131305..131523 Genome browser AA seq 72 aa AA seqDB search MDNRKEIILLELKKLSKKKNISLDDNIKEIGIDSLDLAELVFEAEAKFGVELSDEQLAEI KTVKDIISIFSN NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggataatagaaaagaaataattttattagaacttaaaaagttatcaaaaaagaagaat atttctttggatgataacatcaaggaaataggaattgattctttagatttagctgaactt gtatttgaagcagaagctaaatttggtgttgaactctctgatgaacaattagccgagatc aagactgtaaaggatataatttctattttttctaattaa

DBGET integrated database retrieval system