KEGG   Moraxella veridica: ACE1C5_06745
Entry
ACE1C5_06745      CDS       T11071                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
mvf  Moraxella veridica
Pathway
mvf00190  Oxidative phosphorylation
mvf01100  Metabolic pathways
mvf02020  Two-component system
mvf04148  Efferocytosis
Module
mvf_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:mvf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ACE1C5_06745 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACE1C5_06745 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    ACE1C5_06745 (petA)
Enzymes [BR:mvf01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     ACE1C5_06745 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: XKC35296
LinkDB
Position
1462110..1462694
AA seq 194 aa
MSHAEGVNVKRRRVLIATTAAIGAVGVGAIATPFVRSWYPSAKAEAAGAAVVQDISGIEN
GQMITVKYRGKPIFVVRRTEEMVANLSKVTPKLSDPNSEASIQPEECKNETRSLQPELLV
VEGVCTHLGCAPTYRPEVGAADLGGADWFGGFFCPCHGSLYDLAGRVYNGVPAPTNLPVP
IYSIDGSILTVGEA
NT seq 585 nt   +upstreamnt  +downstreamnt
atgagccatgccgaaggcgtgaatgttaaacgccgtagagtcctaatcgcaaccacagct
gccattggagcggttggtgttggtgcgattgccaccccatttgtgcgatcttggtatcca
agcgccaaagcggaagctgcaggtgccgctgtcgttcaagacatttcaggcattgaaaac
ggtcaaatgatcaccgttaaatatcgcggtaagcccatctttgttgtcagacgtactgaa
gaaatggtggcaaatctaagcaaagtaaccccaaaattaagcgatccaaattctgaggct
tcaatccagcctgaagagtgcaaaaacgaaacgcgctccctgcagccagaacttttggta
gtggaaggtgtgtgtacgcatcttggctgcgcaccgacttaccgtcctgaagtaggcgcg
gcagatttgggtggtgctgattggtttggcggtttcttctgtccttgccatggatctttg
tatgatttggctgggcgtgtttataatggcgtacccgcccctacaaacctacctgtgcca
atttatagtatcgatggctcaatcttgaccgttggggaggcttaa

DBGET integrated database retrieval system