Candidatus Methanosuratincola verstraetei: ACO0C9_00720
Help
Entry
ACO0C9_00720 CDS
T10956
Name
(GenBank) complex I subunit 5 family protein
KO
K00342
NADH-quinone oxidoreductase subunit M [EC:
7.1.1.2
]
Organism
mvj Candidatus Methanosuratincola verstraetei
Pathway
mvj00190
Oxidative phosphorylation
mvj01100
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:
mvj00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
ACO0C9_00720
Enzymes [BR:
mvj01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
ACO0C9_00720
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Proton_antipo_M
Motif
Other DBs
NCBI-ProteinID:
XRH75627
LinkDB
All DBs
Position
complement(137432..138883)
Genome browser
AA seq
483 aa
AA seq
DB search
MELQSNPAVLYLIVALLASSPIALMLERLGRRAPAIFSGAFLTVSGLVLALSGALGGSFF
VIADLPFLGRIALFADGLSSPILAALLAVAGLVSFSGCLGEAKPQRGFQALFLLYVAGVA
GLFLSANLVLVFAFLELTLIASWLAIGWWGGPGRGRASIKYFIYTELGALMLLAGILMLW
GSTGTLDALSAPSSTPASPGAMLGIAFIIAGVFVKSAVFPAHGWLPDAYSESPPRLAAAL
SFSTIAVGAYLLLRIFGSFMPGALSDPRVSGALAAFGLFNIIYGGIAAIRQRDLRRVLSY
SSISQAGYVLIGVASATYVGFLGVLIWAVAHGFGKSALFLISGEYRGSLGTDSLDDLGGL
AGKMPITSSSLLLSFLSLAGIPPTLGFWGEFFILFGFASSLLSAGIDPFRLGVLVLAAAS
TVVSAAYGLWTARRILYGEETPASAGARDRISFALPVIAMVLALVALGIMPFLITGAFWI
YPG
NT seq
1452 nt
NT seq
+upstream
nt +downstream
nt
atggaactccagagcaaccccgctgtactttacttgattgtagccctcttggcgtcctcg
ccgatcgcattaatgctggagaggctggggaggcgcgccccagcgatcttctctggcgcc
ttcctgaccgtttccgggctggtcttggccctgtcaggcgccctcggggggagcttcttc
gtgatcgccgatctgccgttcctgggaaggatcgccctcttcgcagacgggctttcctcc
ccgatcctggccgcgctcctcgcggtagccgggctcgtctcattttccggctgtttggga
gaggcaaagccgcagcgcgggttccaggcgctcttcctcctctatgtcgcgggcgttgcg
ggcctcttcctctcggcaaaccttgtgctggtcttcgccttcctcgagctgacgctcatc
gcctcctggctcgcgatcgggtggtggggcggtccaggcaggggcagggcatcgatcaag
tacttcatctacaccgagctcggggcgctgatgcttctcgccgggatcctgatgctgtgg
gggtcgaccgggacactcgacgccctttccgctccctccagcacgccagcctcgcctgga
gcgatgctcgggattgcattcataatcgccggcgtcttcgtcaagagcgccgtattcccg
gcgcacgggtggctccctgacgcctattccgagtccccgccgaggctcgcggccgccctc
tcgttttccaccatagcggtaggcgcatacctgctgctaaggatcttcggatccttcatg
cccggcgcgctttcggatccacgcgtctcaggggcgctggctgctttcggtctcttcaac
atcatctacggggggatcgcagcgatcaggcagagggatctccggagggtgctctcctac
tcgagcatcagccaggcagggtacgtcctcatcggcgtggcttcggctacatatgtgggg
ttcctcggcgtcctgatctgggcggtcgcgcacgggttcgggaagtccgcgctgttcctc
atctctggggagtaccggggctccctcgggacggactcgcttgatgacctgggagggctc
gctggcaagatgcccattacctcctcatcgctcctcctgtccttcctgagccttgcgggc
atcccgccgacgcttggtttctggggggagttcttcatactcttcgggttcgcctcctcc
ctcctctcagccgggatcgatccattcaggctgggggtgctcgtgctggcagcagcgtcc
accgtggtctcggcagcctacgggctctggaccgcgaggcgtatactgtacggggaggaa
acccctgcgtccgcgggcgcccgggatcggatctctttcgctttgccggtgatcgcgatg
gtcttggcgctcgtcgccctcggcataatgccgttcctgatcactggcgcattctggatc
taccctggctga
DBGET
integrated database retrieval system