KEGG   Methanococcus vannielii: Mevan_0737
Entry
Mevan_0737        CDS       T00554                                 

Name
(GenBank) deoxycytidine triphosphate deaminase
  KO
K09887  dCTP deaminase (dUMP-forming) [EC:3.5.4.30]
Organism
mvn  Methanococcus vannielii
Pathway
mvn00240  Pyrimidine metabolism
mvn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mevan_0737
Enzymes [BR:mvn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.30  dCTP deaminase (dUMP-forming)
     Mevan_0737
SSDB
Motif
Pfam: dUTPase DCD
Other DBs
NCBI-ProteinID: ABR54643
UniProt: A6UQ71
LinkDB
Position
780450..781070
AA seq 206 aa
MILSDKDILNYVNSGRVCINPFNRNFVGPCSYDVTLGEEFITYNEDVYDVKKQLSHRSFK
IDNSIMVCPLHHHLDEKIIERYKEKYSIDCVVSGGLLGTTNEYVELPNDVCAQYQGRSSF
GRVFLQSHQTAGWIDSGFKGKITLEIVAYDKPVILYKNQRIGQLIFSKTLSPADIGYSDR
KCSKYARQTSVMPSLIKKDFENDLEE
NT seq 621 nt   +upstreamnt  +downstreamnt
atgatattaagtgataaggatatattaaattatgttaattcaggacgagtatgtataaat
ccatttaatagaaattttgtaggcccttgttcttatgacgtaacacttggagaagaattt
ataacatataacgaagatgtttatgacgttaagaaacagttaagccataggtcttttaaa
atagataattcaatcatggtatgcccgttacaccaccaccttgatgaaaaaatcattgaa
aggtacaaggaaaaatacagtattgattgtgttgtaagcggcggacttttaggaacgact
aatgaatacgttgagcttccaaatgatgtctgtgcacaataccaaggaagaagcagtttt
ggaagggtatttttacagtcccatcaaactgcagggtggattgattcaggttttaaagga
aaaattactcttgaaattgtagcatacgataaaccagtaattctttataaaaatcaaagg
atagggcagttaatatttagtaaaacactctctccagcagatattggatattcagataga
aaatgttcaaaatatgcacgacagacttcagtaatgccatcacttattaaaaaagacttt
gaaaacgacttggaggaataa

DBGET integrated database retrieval system