Microcystis viridis: myaer102_37310
Help
Entry
myaer102_37310 CDS
T06032
Name
(GenBank) sulfate transporter
KO
K03321
sulfate permease, SulP family
Organism
mvz
Microcystis viridis
Brite
KEGG Orthology (KO) [BR:
mvz00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mvz02000
]
myaer102_37310
Transporters [BR:
mvz02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
myaer102_37310
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
STAS
MFS_MOT1
Motif
Other DBs
NCBI-ProteinID:
BBH41137
UniProt:
A0A3G9JYP5
LinkDB
All DBs
Position
complement(3979781..3981487)
Genome browser
AA seq
568 aa
AA seq
DB search
MPTRLNFSRERFSLPGLKRLRSYRSAWLRGDIIAGITVAAYLVPQCLAYAELAGVQPIAG
LWAILPPLLIYALLGSSPQLSVGPESTTAVMTAAAIMPLVAGDSSNYASLCSLLALLVGS
VCCVAAFARLGFLADLLSKPILVGYMAGVAVIMIVGQLGKISGMSLKAESLFGQIGEFSG
HLSEIHPPTLILAAAVLIFLLVVQRRFPNAPGPLLAVLLATSAVYLFDLNERGIAVIGEI
PAGLPSLKVPRGFSSQQLVYLLSSAIGIALVGYSDNVLTARAFGAKNNYRIDGNQELLAL
GAVNIGNGIMQGFPVSSSGSRTAIGDSLGSRSQLFSLVAFLIVILVLLFLRPLLSLFPKA
ALGAIVIYAALRLIEISEFNRLRCFKTSEFRLALVTMFGVLATDILVGVGVAVGLSVVDL
FTRLMRPHDAVLGEVPNLAGLHDIEDWQGATTIPGLVLYRYDAPLCFANAENFRKRVIAA
IEAEKVPVEWFVLNAEAILDIDITAVDMLKELHRELIGRGITFAMARVKQDLYQQLKKGD
LSETISTERIYATLEKAIEAFHHRKFWV
NT seq
1707 nt
NT seq
+upstream
nt +downstream
nt
atgcctactcgattaaatttttctagggagcggttttccctacccgggttaaagcgtctg
cgatcctatcgctcggcctggttgcggggagatatcattgcggggatcaccgtggcagcc
tatctcgttccccaatgtctggcctatgcggaactggccggagtacaaccgatcgccgga
ttatgggcgatcctaccgccgctgctcatctatgccctgctcggctcctcgccacaactc
tccgtcgggccagaatcgacgacggcagtaatgaccgccgccgctatcatgcccctcgtc
gcgggagatagtagcaactacgccagtctgtgcagtctattagccctactcgtggggagc
gtctgctgcgtcgccgctttcgcccggttggggtttctcgccgatctcctctccaaaccg
atcctcgtcggctacatggccggagtagcggtgatcatgatcgtcggtcagttgggaaaa
attagcgggatgtcactgaaagcggaatcgcttttcggacagatcggggaattttcggga
catttatccgagattcacccaccaactctgattctcgccgccgctgttctaattttcctg
ctagtggtacaacgtcgctttcccaatgcccccggccctttactcgcggttctactggcg
acatcggcagtatatttgttcgatctgaacgagcgaggcatcgccgtgatcggggaaatt
cccgccggtttaccgagtttgaaagtaccgagaggtttttcttcccagcagctcgtctat
ttactctcctcggccatcggtatcgccctcgttggctattccgataacgtcttgaccgcc
cgcgccttcggggcgaaaaacaactatcgcatcgatggcaatcaggaattactcgccctg
ggagcggtgaatatcggtaacggcatcatgcaaggctttcccgtcagcagtagcggcagt
cgcacggcgatcggcgattctctgggcagtcgatcgcaactgttttccctcgtggctttt
ctgatcgtgattttggtacttttgttcttgcgcccgctgctatccctgtttccgaaagcg
gccctgggggcgatcgtgatttacgccgcgctccgtctgatcgagatctcggagttcaac
cgtctgcgttgtttcaaaaccagcgagttccgattggcgctcgtcaccatgttcggtgtc
ctggccaccgatatcctcgtcggggtgggcgttgccgtggggttatcggtggtcgatctg
ttcacgcggctgatgcgaccacacgatgcggttttgggggaagtgccgaatctcgcgggc
ctgcacgacatcgaggattggcagggcgcaacgacgatccccggattggttctctaccgt
tacgacgcgcccctctgtttcgccaacgccgagaattttcggaaacgggtaatagcggcg
atcgaggcggagaaagtccccgtcgagtggttcgttctcaacgccgaagcgattctagat
atcgatattacggcggtcgatatgttgaaagaattacatcgagaattaatcggccgtggt
attactttcgccatggcgcgggtgaagcaagatttatatcagcaattaaaaaaaggagac
ctatccgagacgatctcgaccgaacgtatttatgcaactctagagaaagcgatcgaggcg
tttcatcatcggaaattttgggtctga
DBGET
integrated database retrieval system