Microcystis viridis: myaer102_48730 Help Entry myaer102_48730    CDS       T06032                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mvz  Microcystis viridis Pathway mvz00998   Biosynthesis of various antibiotics mvz01100   Metabolic pathways mvz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mvz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     myaer102_48730 (acpP)    00074 Mycolic acid biosynthesis     myaer102_48730 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     myaer102_48730 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 DUF7080 Motif Other DBs NCBI-ProteinID:  BBH42229 UniProt:  A0A3G9K3F1 LinkDB All DBs Position 5166470..5166718 Genome browser AA seq 82 aa AA seqDB search MSEGIFDRVKKVVVEQLEVEPEKVTPDASFANDLQADSLDVVELVMALEEEFDIEIPDEA AEQIDTVGKAVDHISEKVGATA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaggtattttcgatcgagttaaaaaagttgttgtggaacaattagaagtagag ccggaaaaagttactcccgacgcaagctttgctaatgatctgcaagctgattcccttgat gtggtcgagttagtgatggctttagaggaagaatttgatattgaaattcccgacgaagcg gccgaacaaattgacactgtgggcaaagctgttgaccatattagcgagaaagtaggagca accgcctaa

DBGET integrated database retrieval system