Moellerella wisconsensis: MNY66_09395 Help Entry MNY66_09395       CDS       T07971                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mwi  Moellerella wisconsensis Pathway mwi01100   Metabolic pathways mwi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mwi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MNY66_09395 (acpP)    00074 Mycolic acid biosynthesis     MNY66_09395 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MNY66_09395 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF6137 Motif Other DBs NCBI-ProteinID:  UNH41284 LinkDB All DBs Position complement(2121495..2121731) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVDQLGVKEDEVVNTASFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKITTVQAAIDYVSSASN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaccaactgggtgttaaagag gacgaagttgttaatacggcttcatttgttgatgacttgggcgctgattctcttgacaca gttgagctggttatggctctcgaagaagagttcgattgcgaaatccctgacgaagaagct gaaaagatcactacagtacaggctgctatcgactacgtctcgtccgcaagcaactaa

DBGET integrated database retrieval system