Moellerella wisconsensis: MNY66_14565 Help Entry MNY66_14565       CDS       T07971                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mwi  Moellerella wisconsensis Pathway mwi02024   Quorum sensing mwi03018   RNA degradation Brite KEGG Orthology (KO) [BR:mwi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     MNY66_14565 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     MNY66_14565 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mwi03019]     MNY66_14565 (hfq)    03036 Chromosome and associated proteins [BR:mwi03036]     MNY66_14565 (hfq) Messenger RNA biogenesis [BR:mwi03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      MNY66_14565 (hfq) Chromosome and associated proteins [BR:mwi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     MNY66_14565 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UNH42237 LinkDB All DBs Position complement(3335655..3335954) Genome browser AA seq 99 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPARPVSHHSNNATGTAAPGNYHSGSTPAAQDNDAAE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccgttcctgaacgcattgcgtcgtgaaagggtt ccggtctcaatttatttagttaatggcatcaaattacaaggtcagatcgaatcatttgac cagtttgttattttgctaaaaaacacggtcagccaaatggtgtataaacatgccatttct accgttgttcctgctcgtcctgtttctcatcatagcaacaatgcgacaggtactgcggct ccaggtaattaccattcaggtagtacaccggctgcgcaggataatgatgctgctgaataa

DBGET integrated database retrieval system