Microbacterium wangruii: QNO26_07735 Help Entry QNO26_07735       CDS       T11147                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mwn  Microbacterium wangruii Pathway mwn01100   Metabolic pathways mwn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mwn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QNO26_07735    00074 Mycolic acid biosynthesis     QNO26_07735   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QNO26_07735 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 AstC-like_C Motif Other DBs NCBI-ProteinID:  WIM27078 LinkDB All DBs Position 1642955..1643203 Genome browser AA seq 82 aa AA seqDB search MAYTNDEVLAGLAELITDETGISADEVAMEKSFTDDLDIDSISMMTIVVNAEEKFGVTIP DEEVKNLKTVGDAVTYITSNQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcttacacgaacgacgaggtccttgccggacttgccgaactgatcaccgacgagacc ggcatctccgccgacgaggtcgccatggagaagtcgttcaccgacgacctcgacatcgac tccatctcgatgatgacgatcgtcgtcaacgccgaggagaagttcggcgtcaccatccca gacgaagaggtcaagaacctcaagaccgtcggcgacgccgtcacctacatcacgtccaac caggcctga

DBGET integrated database retrieval system