Methanothermobacter wolfeii: MWSIV6_0233 Help Entry MWSIV6_0233       CDS       T04587                                  Name (GenBank) Archaeal histone H3/H4   KO K24450   DNA-binding protein Organism mwo  Methanothermobacter wolfeii Brite KEGG Orthology (KO) [BR:mwo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mwo03036]     MWSIV6_0233 Chromosome and associated proteins [BR:mwo03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     MWSIV6_0233 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C CENP-S LonB_AAA-LID TFIID_20kDa TFIID-31kDa Bromo_TP HK97-gp10_like Motif Other DBs NCBI-ProteinID:  SCM55940 LinkDB All DBs Position I:complement(223300..223506) Genome browser AA seq 68 aa AA seqDB search MAELPITPVGRIIKNAGAQRISDDAREELARALEEEGMKIAREAVKLAKHAGRKTVKKSD IELAVKKV NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggccgaattacctataacaccagttgggagaataataaaaaatgccggtgcccagaga ataagtgatgatgcaagagaagaacttgcaagggcccttgaagaagagggcatgaaaatt gcaagagaagcagttaaacttgcaaaacacgccggcagaaaaaccgtgaagaaatcagac atcgaactggccgttaaaaaagtataa

DBGET integrated database retrieval system