Methanothermobacter wolfeii: MWSIV6_0684 Help Entry MWSIV6_0684       CDS       T04587                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mwo  Methanothermobacter wolfeii Pathway mwo03010   Ribosome Brite KEGG Orthology (KO) [BR:mwo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MWSIV6_0684 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MWSIV6_0684 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mwo03011]     MWSIV6_0684 (rps27ae)    04121 Ubiquitin system [BR:mwo04121]     MWSIV6_0684 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mwo04147]     MWSIV6_0684 (rps27ae) Ribosome [BR:mwo03011]  Ribosomal proteins   Eukaryotes    Small subunit     MWSIV6_0684 (rps27ae)   Archaea     MWSIV6_0684 (rps27ae) Ubiquitin system [BR:mwo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MWSIV6_0684 (rps27ae) Exosome [BR:mwo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MWSIV6_0684 (rps27ae)   Exosomal proteins of colorectal cancer cells    MWSIV6_0684 (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e NCD3G Zn_ribbon_4 Motif Other DBs NCBI-ProteinID:  SCM56754 UniProt:  A0A9E7RVW5 LinkDB All DBs Position I:604503..604658 Genome browser AA seq 51 aa AA seqDB search MKKFELYEVKDDKLVRKNPFCVRCSNGVFMADHGDRYACGKCGYTEWKTRE NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgaagaagtttgaactctatgaggtaaaggatgataaactcgtaaggaagaatcccttc tgcgtcagatgctcaaacggtgtcttcatggcagaccatggggatagatacgcctgcggt aaatgcggatacacagaatggaaaaccagggaatag

DBGET integrated database retrieval system