Myxococcus xanthus: MXAN_6637 Help Entry MXAN_6637         CDS       T00366                                  Symbol acp Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mxa  Myxococcus xanthus Pathway mxa01100   Metabolic pathways mxa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mxa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MXAN_6637 (acp)    00074 Mycolic acid biosynthesis     MXAN_6637 (acp)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MXAN_6637 (acp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABF91660 UniProt:  Q1CXW9 LinkDB All DBs Position complement(8166707..8166964) Genome browser AA seq 85 aa AA seqDB search MTEIHRIVTEELEWKGAVEPSQDLVRDLQLDSLGLTVLAVGLENRFRIRLSEEDAQGVRT VGDLAKLVAQRVAAPVEPRPEEALP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacggagattcatcgcatcgtcaccgaggagctggagtggaagggcgcggtggagccc tcgcaggacctggtgcgggacctccagttggacagcctgggcctcacggtgctggcggtg gggctggagaaccgcttccgcatccgcctgtccgaagaggacgcgcagggcgtgcgcacg gtgggagacctggcgaagctggtggcgcagcgggtcgcggctccggtggaacccaggccg gaggaggccctgccgtga

DBGET integrated database retrieval system