Mycobacterium xenopi: MYXE_12490 Help Entry MYXE_12490        CDS       T06649                                  Name (GenBank) hypothetical protein   KO K04093   chorismate mutase [EC:5.4.99.5] Organism mxe  Mycobacterium xenopi Pathway mxe00400   Phenylalanine, tyrosine and tryptophan biosynthesis mxe01100   Metabolic pathways mxe01110   Biosynthesis of secondary metabolites mxe01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:mxe00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     MYXE_12490 Enzymes [BR:mxe01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      MYXE_12490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 DivIC Med21 DUF632 SPATA1_C DUF7121 Motif Other DBs NCBI-ProteinID:  BBU21460 UniProt:  A0AAD1M0I2 LinkDB All DBs Position complement(1277964..1278221) Genome browser AA seq 85 aa AA seqDB search METEQLPDIDELRQEIDRLDAEILAAVKRRTEISREIGKLRMASGGTRLVHSREMKVIER YSELGPDGKDLAMLLLRMGRGRLGH NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaaaccgaacagcttcctgacatcgacgagctgcggcaggaaatcgaccgcctcgat gccgagatcctcgccgcagtcaaacgccgcaccgagatatcccgggaaatcggcaagctg cggatggcctccggcggcacccgtctggtgcacagccgtgagatgaaggtcatcgagcgc tacagcgagcttggtcccgacggcaaagatctggccatgcttttgcttcggatgggccga ggtcggctcggtcactag

DBGET integrated database retrieval system