Mycobacterium xenopi: MYXE_20100 Help Entry MYXE_20100        CDS       T06649                                  Name (GenBank) hypothetical protein   KO K00384   thioredoxin reductase (NADPH) [EC:1.8.1.9] Organism mxe  Mycobacterium xenopi Pathway mxe00450   Selenocompound metabolism Brite KEGG Orthology (KO) [BR:mxe00001]  09100 Metabolism   09106 Metabolism of other amino acids    00450 Selenocompound metabolism     MYXE_20100 Enzymes [BR:mxe01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.1  With NAD+ or NADP+ as acceptor     1.8.1.9  thioredoxin-disulfide reductase (NADPH)      MYXE_20100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Thioredoxin_2 Redoxin Motif Other DBs NCBI-ProteinID:  BBU22220 UniProt:  A0AAD1H0K8 LinkDB All DBs Position 2061201..2061449 Genome browser AA seq 82 aa AA seqDB search MTVENVSRADFESTILENSMVIVDFWAQWCGPCRAFAPVFGRSAHDHPDIVHAKVDTDAE RELAAIASIRRKVPLSRRAERR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaccgtcgaaaacgtcagccgggcggatttcgaatcgacgatcctggagaactcgatg gtaatcgtcgacttctgggcgcagtggtgtggcccttgccgggccttcgcgccagtcttc ggacggtctgcccacgaccaccctgacatcgtgcacgccaaagtcgataccgacgcggag cgtgaactggccgcaatcgccagtatccggcgcaaggtaccgctcagccgtcgcgccgaa cggcggtga

DBGET integrated database retrieval system