Myotis brandtii (Brandt's bat): 102239158 Help Entry 102239158         CDS       T02920                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04081   Hormone signaling myb04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     102239158 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     102239158 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myb04052]     102239158 (GAST) Cytokines and neuropeptides [BR:myb04052]  Neuropeptides   GPCR binding    102239158 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  102239158 NCBI-ProteinID:  XP_005862021 UniProt:  S7MLD6 LinkDB All DBs Position Un AA seq 104 aa AA seqDB search MQRLCVQALILALALAAFSEASWKPRSQLQDAPSGPGAKRALEARWPDQLGPAPHHQRQL RFPDPPHRVADLSKKQGPWLEEEEEAYGWMDFGRRSAEEGDQEP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcggctgtgtgtgcaagcgctgatcctggctctggctctggccgccttctcggaa gcctcctggaagccccgctcccagctgcaggacgcaccctcgggcccaggggccaagagg gccctggaggcacgttggccggaccagctgggcccagctcctcaccaccaaaggcagctg aggttcccggatcccccacaccgggtggcagacctgtccaagaagcaggggccgtggctg gaggaagaggaagaagcgtatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaagagccctag

DBGET integrated database retrieval system