Myotis brandtii (Brandt's bat): 102239557 Help Entry 102239557         CDS       T02920                                  Symbol GNAI3 Name (RefSeq) G protein subunit alpha i3   KO K04630   guanine nucleotide-binding protein G(i) subunit alpha Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04015   Rap1 signaling pathway myb04022   cGMP-PKG signaling pathway myb04024   cAMP signaling pathway myb04062   Chemokine signaling pathway myb04071   Sphingolipid signaling pathway myb04081   Hormone signaling myb04082   Neuroactive ligand signaling myb04261   Adrenergic signaling in cardiomyocytes myb04360   Axon guidance myb04371   Apelin signaling pathway myb04540   Gap junction myb04611   Platelet activation myb04670   Leukocyte transendothelial migration myb04713   Circadian entrainment myb04723   Retrograde endocannabinoid signaling myb04724   Glutamatergic synapse myb04725   Cholinergic synapse myb04726   Serotonergic synapse myb04727   GABAergic synapse myb04728   Dopaminergic synapse myb04730   Long-term depression myb04914   Progesterone-mediated oocyte maturation myb04915   Estrogen signaling pathway myb04916   Melanogenesis myb04921   Oxytocin signaling pathway myb04923   Regulation of lipolysis in adipocytes myb04924   Renin secretion myb04926   Relaxin signaling pathway myb04928   Parathyroid hormone synthesis, secretion and action myb04934   Cushing syndrome myb04935   Growth hormone synthesis, secretion and action myb04971   Gastric acid secretion myb05012   Parkinson disease myb05030   Cocaine addiction myb05032   Morphine addiction myb05034   Alcoholism myb05133   Pertussis myb05142   Chagas disease myb05145   Toxoplasmosis myb05163   Human cytomegalovirus infection myb05170   Human immunodeficiency virus 1 infection myb05200   Pathways in cancer myb05207   Chemical carcinogenesis - receptor activation Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102239557 (GNAI3)    04371 Apelin signaling pathway     102239557 (GNAI3)    04071 Sphingolipid signaling pathway     102239557 (GNAI3)    04024 cAMP signaling pathway     102239557 (GNAI3)    04022 cGMP-PKG signaling pathway     102239557 (GNAI3)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     102239557 (GNAI3)    04081 Hormone signaling     102239557 (GNAI3)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     102239557 (GNAI3)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102239557 (GNAI3)    04670 Leukocyte transendothelial migration     102239557 (GNAI3)    04062 Chemokine signaling pathway     102239557 (GNAI3)   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     102239557 (GNAI3)    04915 Estrogen signaling pathway     102239557 (GNAI3)    04914 Progesterone-mediated oocyte maturation     102239557 (GNAI3)    04921 Oxytocin signaling pathway     102239557 (GNAI3)    04926 Relaxin signaling pathway     102239557 (GNAI3)    04935 Growth hormone synthesis, secretion and action     102239557 (GNAI3)    04928 Parathyroid hormone synthesis, secretion and action     102239557 (GNAI3)    04916 Melanogenesis     102239557 (GNAI3)    04924 Renin secretion     102239557 (GNAI3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102239557 (GNAI3)   09154 Digestive system    04971 Gastric acid secretion     102239557 (GNAI3)   09156 Nervous system    04724 Glutamatergic synapse     102239557 (GNAI3)    04727 GABAergic synapse     102239557 (GNAI3)    04725 Cholinergic synapse     102239557 (GNAI3)    04728 Dopaminergic synapse     102239557 (GNAI3)    04726 Serotonergic synapse     102239557 (GNAI3)    04730 Long-term depression     102239557 (GNAI3)    04723 Retrograde endocannabinoid signaling     102239557 (GNAI3)   09158 Development and regeneration    04360 Axon guidance     102239557 (GNAI3)   09159 Environmental adaptation    04713 Circadian entrainment     102239557 (GNAI3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102239557 (GNAI3)    05207 Chemical carcinogenesis - receptor activation     102239557 (GNAI3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102239557 (GNAI3)    05163 Human cytomegalovirus infection     102239557 (GNAI3)   09171 Infectious disease: bacterial    05133 Pertussis     102239557 (GNAI3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102239557 (GNAI3)    05142 Chagas disease     102239557 (GNAI3)   09164 Neurodegenerative disease    05012 Parkinson disease     102239557 (GNAI3)   09165 Substance dependence    05030 Cocaine addiction     102239557 (GNAI3)    05032 Morphine addiction     102239557 (GNAI3)    05034 Alcoholism     102239557 (GNAI3)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102239557 (GNAI3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myb04147]     102239557 (GNAI3)    04031 GTP-binding proteins [BR:myb04031]     102239557 (GNAI3) Exosome [BR:myb04147]  Exosomal proteins   Proteins found in most exosomes    102239557 (GNAI3) GTP-binding proteins [BR:myb04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 1 (Gi/o) [OT]     102239557 (GNAI3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-alpha Arf Motif Other DBs NCBI-GeneID:  102239557 NCBI-ProteinID:  XP_005860175 LinkDB All DBs Position Un AA seq 341 aa AA seqDB search MFQVPQEWPLVHEVVGQGQNTRKRPRGAGESGKSTIVKQMKIIHEDGYSEEECKQYRVVV YSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIRRLWRD GGVQACFCRSREYQLNDSASYYLNDLERISQTNYIPTQQDVLRTRVKTTGIVETHFTFKE LYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSI CNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRR KDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKHNLKECGLY NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt atgttccaggtgccacaagaatggccactagtacacgaggtagtgggacaaggacaaaac acaaggaaacgcccgagaggtgctggagaatctggtaaaagcaccattgtgaaacagatg aaaatcattcatgaggacggctattcggaggaagaatgtaaacagtatagagtagttgtc tacagcaacacgatacagtccattattgccatcatacgagccatgggacggctaaagatc gactttggggaagcagccagagcagatgatgcccggcagttatttgtcttagctggcagt gccgaggaaggagtcatgaccccggaactggcaggagtgattagacggctgtggcgagat ggtggcgtgcaggcttgcttctgcagatccagggagtaccagctcaacgattctgcctca tattacctaaatgatttggaaagaatatcccaaaccaactacattccaactcagcaagat gtcctgcggacaagagtgaagaccacaggcattgtggaaacgcatttcaccttcaaagaa ctgtacttcaagatgtttgatgtaggcggccaaagatcggaacgaaaaaagtggattcac tgttttgaaggagtgacagccatcatcttctgtgtggctctcagtgactatgaccttgtt ctggctgaggatgaggagatgaaccgaatgcatgaaagcatgaaactgtttgacagcatt tgtaacaacaaatggtttacagacacttcaatcattctcttcctcaacaagaaagatctt tttgaggaaaaaataaagaggagtccattaactatctgttatccagaatacacgggttcc aacacgtacgaagaggcagctgcttacatccagtgccagtttgaagacctgaacagaagg aaggacaccaaggagatctacacccacttcacctgtgccaccgacaccaagaacgtgcag tttgtttttgacgctgtcacggatgtcatcattaagcacaacctgaaggagtgtgggctt tactga

DBGET integrated database retrieval system