Myotis brandtii (Brandt's bat): 102240210 Help Entry 102240210         CDS       T02920                                  Symbol PFN2 Name (RefSeq) profilin 2   KO K05759   profilin Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04015   Rap1 signaling pathway myb04810   Regulation of actin cytoskeleton myb05014   Amyotrophic lateral sclerosis myb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102240210 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102240210 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102240210 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102240210 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myb04131]     102240210 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:myb04812]     102240210 (PFN2)    04147 Exosome [BR:myb04147]     102240210 (PFN2) Membrane trafficking [BR:myb04131]  Others   Actin-binding proteins    Others     102240210 (PFN2) Cytoskeleton proteins [BR:myb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102240210 (PFN2) Exosome [BR:myb04147]  Exosomal proteins   Proteins found in most exosomes    102240210 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102240210 NCBI-ProteinID:  XP_005863535 LinkDB All DBs Position Un AA seq 99 aa AA seqDB search MIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRV LVFVMGKEGVHGGGLNKKAYSMANIGYSHGKGRCPRRHT NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgattgtaggaaaagatcgggaaggtttctttaccaacggtttgactcttggcgcaaag aagtgctcagtgatcagagacagtctgtatgtggatggtgactgcacaatggacatcagg acaaagagtcaaggtggggagccaacatacaacgttgcagtgggcagagctggcagagtc ttggtctttgtaatgggaaaagaaggggtccatggaggcggcttgaataagaaggcatac tcaatggcaaacattggttatagtcatgggaaaggaaggtgtccacggaggcacacttaa

DBGET integrated database retrieval system