Myotis brandtii (Brandt's bat): 102240268 Help Entry 102240268         CDS       T02920                                  Symbol BAK1 Name (RefSeq) BCL2 antagonist/killer 1   KO K14021   Bcl-2 homologous antagonist/killer Organism myb  Myotis brandtii (Brandt's bat) Pathway myb01524   Platinum drug resistance myb04141   Protein processing in endoplasmic reticulum myb04210   Apoptosis myb04215   Apoptosis - multiple species myb05022   Pathways of neurodegeneration - multiple diseases myb05132   Salmonella infection myb05160   Hepatitis C myb05162   Measles myb05163   Human cytomegalovirus infection myb05164   Influenza A myb05165   Human papillomavirus infection myb05167   Kaposi sarcoma-associated herpesvirus infection myb05168   Herpes simplex virus 1 infection myb05169   Epstein-Barr virus infection myb05170   Human immunodeficiency virus 1 infection myb05200   Pathways in cancer myb05202   Transcriptional misregulation in cancer myb05203   Viral carcinogenesis myb05206   MicroRNAs in cancer myb05210   Colorectal cancer myb05212   Pancreatic cancer myb05213   Endometrial cancer myb05214   Glioma myb05216   Thyroid cancer myb05217   Basal cell carcinoma myb05218   Melanoma myb05220   Chronic myeloid leukemia myb05222   Small cell lung cancer myb05223   Non-small cell lung cancer myb05224   Breast cancer myb05225   Hepatocellular carcinoma myb05226   Gastric cancer Brite KEGG Orthology (KO) [BR:myb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102240268 (BAK1)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102240268 (BAK1)    04215 Apoptosis - multiple species     102240268 (BAK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102240268 (BAK1)    05202 Transcriptional misregulation in cancer     102240268 (BAK1)    05206 MicroRNAs in cancer     102240268 (BAK1)    05203 Viral carcinogenesis     102240268 (BAK1)   09162 Cancer: specific types    05210 Colorectal cancer     102240268 (BAK1)    05212 Pancreatic cancer     102240268 (BAK1)    05225 Hepatocellular carcinoma     102240268 (BAK1)    05226 Gastric cancer     102240268 (BAK1)    05214 Glioma     102240268 (BAK1)    05216 Thyroid cancer     102240268 (BAK1)    05220 Chronic myeloid leukemia     102240268 (BAK1)    05217 Basal cell carcinoma     102240268 (BAK1)    05218 Melanoma     102240268 (BAK1)    05213 Endometrial cancer     102240268 (BAK1)    05224 Breast cancer     102240268 (BAK1)    05222 Small cell lung cancer     102240268 (BAK1)    05223 Non-small cell lung cancer     102240268 (BAK1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102240268 (BAK1)    05160 Hepatitis C     102240268 (BAK1)    05164 Influenza A     102240268 (BAK1)    05162 Measles     102240268 (BAK1)    05168 Herpes simplex virus 1 infection     102240268 (BAK1)    05163 Human cytomegalovirus infection     102240268 (BAK1)    05167 Kaposi sarcoma-associated herpesvirus infection     102240268 (BAK1)    05169 Epstein-Barr virus infection     102240268 (BAK1)    05165 Human papillomavirus infection     102240268 (BAK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     102240268 (BAK1)   09164 Neurodegenerative disease    05022 Pathways of neurodegeneration - multiple diseases     102240268 (BAK1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102240268 (BAK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:myb03029]     102240268 (BAK1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:myb02000]     102240268 (BAK1) Mitochondrial biogenesis [BR:myb03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     102240268 (BAK1) Transporters [BR:myb02000]  Other transporters   Pores ion channels [TC:1]    102240268 (BAK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102240268 NCBI-ProteinID:  XP_005878084 UniProt:  S7ND21 LinkDB All DBs Position Un AA seq 210 aa AA seqDB search MASGQGPGPPRQDCEGPAPASNSEEQVARDTEEVFRSYVYYRHQQEQEAEAAAPPDPEMV TLSPEPDSTLGQVGRQLAIIGDDINQRFDLEFHTMLQHLQPTPENAYQYFTKIASSLFES GINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFILHHCIARWIAQRGGWVAAL DLGNGPIRNVLIVLAVVLLGQFVVRRFFQS NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggcatctgggcaaggaccgggccctcccaggcaggactgtgaagggcctgccccggcc tccaattcggaggagcaggtggcccgggacacagaggaggttttccgcagctacgtttat taccgccatcagcaggagcaggaagctgaggcggctgccccccctgacccagagatggtc accttgtccccagagcctgacagcaccttggggcaggtgggccggcagctcgccatcatc ggggacgacatcaaccagcgcttcgacttggagttccacaccatgttgcagcacctgcag ccgaccccagagaacgcctaccagtacttcaccaagatcgcctccagcctgtttgagagc ggcatcaactggggccgggtggtggctctcctgggcttcggctaccgcctggccctccac gtctaccagcgaggcctgaccggcttcctgggccaggtgacccgcttcgtggccgacttc attctgcatcactgcatcgcccggtggatcgcgcagaggggcggctgggtggcagccctg gacctgggcaacggccccatccggaatgtgctgatagttctggctgtggttctgttgggc cagtttgtggtacgaagattcttccagtcatga

DBGET integrated database retrieval system