Myotis brandtii (Brandt's bat): 102242181 Help Entry 102242181         CDS       T02920                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04024   cAMP signaling pathway myb04080   Neuroactive ligand-receptor interaction myb04081   Hormone signaling myb04935   Growth hormone synthesis, secretion and action myb04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102242181 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102242181 (SST)    04081 Hormone signaling     102242181 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     102242181 (SST)   09154 Digestive system    04971 Gastric acid secretion     102242181 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myb04052]     102242181 (SST) Cytokines and neuropeptides [BR:myb04052]  Neuropeptides   GPCR binding    102242181 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  102242181 NCBI-ProteinID:  XP_005876331 UniProt:  S7NAB7 LinkDB All DBs Position Un AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALNGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAADQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtcctggctttgaac ggtgtcaccggcgcgccctcggatccccgactccgtcagtttctgcagaaatccctggct gctgccgcagggaagcaggaactagccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaatgatgccctggaacctgaagatttgtcccaggctgctgaccaggat gaaatgaggctggagctgcagagatccactaactcgaacccggccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system