KEGG   Myotis brandtii (Brandt's bat): 102242521
Entry
102242521         CDS       T02920                                 
Symbol
ITGAX
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04610  Complement and coagulation cascades
myb04810  Regulation of actin cytoskeleton
myb05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102242521 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102242521 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102242521 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:myb04515]
    102242521 (ITGAX)
   04090 CD molecules [BR:myb04090]
    102242521 (ITGAX)
Cell adhesion molecules [BR:myb04515]
 Integrins
  Integrin alpha subunits
   102242521 (ITGAX)
CD molecules [BR:myb04090]
 Proteins
  102242521 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE
Other DBs
NCBI-GeneID: 102242521
NCBI-ProteinID: XP_014385280
LinkDB
Position
Un
AA seq 1123 aa
MSRTRTSLLLLMGVASSLCFNLDIDKPTIFPMHSAGFGHSVVQYANGVVVGAPLEIKAVN
QTGGLYRCDYSTATCEPIQLQTPPEAVNMSLGLSLTAATTPPRLLACGPTVHHACNENMH
LAGFCFLWASSSWPTQRLPDALQECPRQEQDIVFLIDGSGSIKPMEFTQMLNFVKAVMSQ
FQRPRAQFSLMQFSSTFWVHFTFKQFSQSSNPLRLLDSVTKLDGRTYTASAILRVTEELF
SAQKGARQDASKILIVITDGEKVGDNLEYENVISRAEDKGIVRYAVGVGSAFQKASAFAE
LNAIASRPSQEHIFRVDNFDALRDIQKQLKEKIFAIEGTHTVSSSSFQFEMSQEGFSAVL
TPVSGPFRHRSPSGYSTELALWKGVQSLVLGAPRHQHTGKAVIFTQAAGQWRPKAEVTGT
QIGSYFGASLCSVDVDRDGSSDLVLIGAPHYYEPTRGGQVSVCPFPRGARWQCRAILRGE
QGHPWGRFGAALTAMGDVNGDKLTDVAIGAPGEEENRGAVYLFHGASGPGISPSHSQRIT
GSQLSPGLQHFGQSLSGGQDLTLDGLVDLAVGAQGHALLLRTRPVLRVWVEIRTTPTEIA
RSVFECRENTASIRDLGDARVCLRVHESPRTRLGNLQSDVTFDLTLDPGHLSPRAIFKET
NTRHLSRVRVLDLRQHCEDVKLLLPACVEDAMIPITLSLNFSLVGKPIPSFGNLQPILAP
DTRRHFTASLPFEKNCGDDRVCQDDLGITVDASGLETLVVGNTLELNMGVKVWNDGEDSY
GTTVTFSYPPGLSYRRATVSQSRPQSRSLQLACDSGSQDAWSTRCSLKHIIFREGAQVTF
VATFDVSPKAMLGDRLLLTANVSSENNSPRTSRTTSQLELPVKYSVYTVVSSHEESTKYL
NFSASEEEGSSVTQLRYQVSNLGQRDLPVSIYFLVPVELNQVAVWTELELLYPQGPSMNC
SSERTVPTEADPRAHMQKNPVLDCSVAACRRFRCDVPSFGTQEELDFTLKGNLSFGWVSQ
TLQKKVSVVSVAEITFDRSVYAQLPGQEASLRAQTEVVLEKQEVHNPVPLIVGSSVGGLL
LLALITAILYKVGFFKRQYKEMMAEANEQAAPENGPSDPQGGQ
NT seq 3372 nt   +upstreamnt  +downstreamnt
atgagcaggaccaggacatcccttctcctgttgatgggcgtggcttcctctctctgcttc
aacttggacattgacaagccgaccatcttccccatgcacagcgccgggtttggacacagt
gtggtccagtacgccaacggggtggtggtgggagcccccctggagataaaggctgtcaac
caaaccggtggcctctaccggtgtgactacagcacggccacctgtgagcccatccagctg
cagacccccccagaggctgtgaacatgtccctgggcctgtccctgacagctgccaccaca
ccccctcggctgctggcctgtggccccaccgtgcaccatgcatgcaacgagaacatgcac
ttggccgggttctgcttcctgtgggcctcctcttcctggccgacccagaggctcccagat
gccctgcaggagtgcccgaggcaggagcaggacatcgtgttcctgatcgacggctcaggc
agcatcaaacccatggagtttacccagatgctgaacttcgtgaaggctgtgatgagccag
ttccagagacccagggcccagttctccctgatgcagttctccagcaccttctgggttcac
ttcacgttcaagcaattctcgcagagctcaaacccactacggctgctggactctgtgacc
aagctggatgggcgcacatacacggcctcagctatcctgagggtcacagaagagctgttc
agtgcccagaagggggccagacaggacgcctccaagatcctcatcgtcatcacggacggg
gagaaagtaggcgacaacctggaatatgagaatgtcatctcccgggccgaggacaagggc
atcgtccgctatgcggtcggggtggggtcggcttttcagaaagcaagcgccttcgcagaa
ctgaacgccatcgcgtccaggccctcgcaggagcacatattcagagtggacaactttgat
gctctgagagacattcaaaagcagctgaaagagaagatctttgccattgagggtacccac
accgtgagcagcagctccttccagttcgagatgtcccaggagggcttcagcgcggtgctc
acgcctgtgagtgggcccttccggcaccggtccccctcaggttactccaccgagctggcc
ctttggaagggggtgcagagcctggtcctgggggccccccgccatcagcacaccgggaag
gccgtcatcttcacccaggcggccgggcagtggaggccgaaggctgaagtcacagggacc
cagattggctcctacttcggggcctccctctgctccgtggacgtggacagagatggcagc
tccgacctggtcctcatcggggctccccattactacgagccgacccgggggggccaggtg
tccgtgtgcccctttccccggggggccaggtggcagtgccgggccattctccgtggggag
cagggccacccctggggccgctttggggcagccctgaccgccatgggggacgtgaatggg
gacaagctgacggacgtggccatcggggccccgggggaagaggagaaccggggtgctgtg
tacctgttccacggagcctcggggccgggcatcagcccctcccacagccagaggatcaca
ggctcccagctctcccctgggctccagcactttggacagtcgctgagcgggggccaggac
ctcaccctggatggccttgtggacctggccgtgggggcccaggggcacgcactgctgctc
aggaccagacctgtgctcagggtgtgggtggagatccgcacaacacccacagagattgct
aggtctgtgttcgagtgtcgggagaacacagcctccatccgggacctgggtgatgccaga
gtctgccttcgtgtccatgaaagtcccaggacccggctgggtaacctccaaagtgatgtg
acctttgacctgacccttgaccctggccacctgagtccccgagccatcttcaaggagacg
aacactcggcatctgagtcgagtcagagtccttgatctgagacagcactgcgaggacgtg
aagctgctgctcccggcttgcgtggaggacgcgatgatccccatcaccttgagtctcaat
ttctccctggtgggcaagcccatcccatcctttgggaacctccagcctattctggccccg
gacacccgcagacacttcacggcctctctcccctttgagaagaactgtggggacgaccgt
gtctgccaggacgaccttggcatcaccgttgacgcctctggcttggagaccctggtggtg
gggaacaccctggagctgaacatgggagtgaaagtgtggaatgatggtgaggactcctat
gggaccacggtcaccttctcctacccgccagggctgtcctaccgacgggcaacagtcagc
cagagccggccacagtcacgctccctgcaactggcctgcgacagcgggagccaggacgcc
tggagcacgcgctgcagcctcaaacacatcatcttccgcgagggagctcaggtcaccttc
gtggccacctttgacgtctcccccaaggccatgctgggagaccggctgcttctaacggcc
aacgtgagcagtgagaacaactcccccaggaccagcaggaccacctcccagctggagctg
ccggtgaagtactccgtctacaccgtggtcagcagccacgaagaatccaccaagtacctc
aacttctcggcctcggaggaggaggggagcagcgtgacccagctccgataccaggtgagc
aacctggggcagagggacctgcctgtcagcatctacttcctggtgcctgtggagctgaac
caggtggcggtgtggacagagctggagctcctctacccccagggcccatctatgaactgc
tcttcagagagaacagtgcccacagaggccgacccccgggcccacatgcagaagaatccc
gtgctggactgctccgttgctgcctgccggaggttccgctgtgacgtcccctccttcggc
acccaagaggaactggacttcaccctgaagggcaacctcagcttcggctgggtcagccag
actctgcagaagaaggtatcggtggtgagtgtggcggaaatcacgttcgacagatctgtg
tatgcccagctcccgggccaggaggcgtctctgagagcccagacggaggtggtgctggag
aagcaggaggtccacaaccccgtgcccctcattgtgggcagctccgtgggaggactgctg
ctgctggctctcatcacagccatactgtacaaggttggcttctttaaacgtcagtacaaa
gagatgatggcggaagcaaatgaacaagctgccccagaaaatggaccatcggacccccaa
ggtggccaataa

DBGET integrated database retrieval system