Myotis brandtii (Brandt's bat): 102243592 Help Entry 102243592         CDS       T02920                                  Symbol CSNK2B Name (RefSeq) casein kinase 2 beta   KO K03115   casein kinase II subunit beta Organism myb  Myotis brandtii (Brandt's bat) Pathway myb03008   Ribosome biogenesis in eukaryotes myb03083   Polycomb repressive complex myb04064   NF-kappa B signaling pathway myb04137   Mitophagy - animal myb04310   Wnt signaling pathway myb04520   Adherens junction myb05010   Alzheimer disease myb05020   Prion disease myb05022   Pathways of neurodegeneration - multiple diseases myb05162   Measles myb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:myb00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     102243592 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     102243592 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102243592 (CSNK2B)    04064 NF-kappa B signaling pathway     102243592 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102243592 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     102243592 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102243592 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     102243592 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102243592 (CSNK2B)    05020 Prion disease     102243592 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     102243592 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:myb03009]     102243592 (CSNK2B)    03036 Chromosome and associated proteins [BR:myb03036]     102243592 (CSNK2B) Ribosome biogenesis [BR:myb03009]  Eukaryotic type   90S particles    Kinase     102243592 (CSNK2B) Chromosome and associated proteins [BR:myb03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      102243592 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  102243592 NCBI-ProteinID:  XP_005859935 UniProt:  S7MH75 LinkDB All DBs Position Un AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatctcctggttctgtgggctccgtggcaatgag ttcttctgtgaagtggatgaagactacatccaggacaaattcaatctcactgggctcaac gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagtgacctgattgagcaggcagctgagatgctgtat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaaa taccagcagggagactttggctactgtccacgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggggaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcctcgaggcaccaccacacggacggcgcgtacttcggc actggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagcggcctgcc aaccagtttgtgcccaggctctatggtttcaagatccatccgatggcctaccagctgcag ctccaagccgctagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system