KEGG Orthology (KO) [BR:myb00001]
09140 Cellular Processes
09141 Transport and catabolism
04144 Endocytosis
102244272 (CHMP4C)
09143 Cell growth and death
04217 Necroptosis
102244272 (CHMP4C)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:myb04131]
102244272 (CHMP4C)
03400 DNA repair and recombination proteins [BR:myb03400]
102244272 (CHMP4C)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:myb04147]
102244272 (CHMP4C)
Membrane trafficking [BR:myb04131]
Endosome - Lysosome transport
Endosomal sorting complexes required for transport (ESCRT)
ESCRT-III complex
102244272 (CHMP4C)
DNA repair and recombination proteins [BR:myb03400]
Eukaryotic type
Check point factors
Other check point factors
102244272 (CHMP4C)
Exosome [BR:myb04147]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
102244272 (CHMP4C)
Exosomal proteins of colorectal cancer cells
102244272 (CHMP4C)
172 aa
CLAALQALKRKKRLEKQLSQIDGTLSTVEFQREALENAHTNTEVLRSMGLAAKAMRAAHE
NMDLNKIDDLMQEITEQQDVAQEISEAFSQHTGFGEDFDEDELMAELEELEQEELNKKMT
NIRLPNVPSTSLPAQPDRTPGSLGPATRPRAAPSRRAGGEDEDLQHLAAWAS