Myotis brandtii (Brandt's bat): 102245818 Help Entry 102245818         CDS       T02920                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04613   Neutrophil extracellular trap formation myb05034   Alcoholism myb05202   Transcriptional misregulation in cancer myb05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:myb00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102245818  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102245818   09163 Immune disease    05322 Systemic lupus erythematosus     102245818   09165 Substance dependence    05034 Alcoholism     102245818  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:myb03036]     102245818   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myb04147]     102245818 Chromosome and associated proteins [BR:myb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102245818 Exosome [BR:myb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102245818 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  102245818 NCBI-ProteinID:  XP_014395339 UniProt:  S7MTZ9 LinkDB All DBs Position Un AA seq 136 aa AA seqDB search MARSKQTAHKSTGGKMPRKQLATKAARKSAPSMGGVKKPHRYRPGTVALREICCYQKSTE LLILKLPFQRLVREIAQDFRTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIQGEKA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaagcaagcagactgctcacaaatccacgggtgggaaaatgccccgcaaacag ctggccactaaagctgccaggaaaagtgccccctctatgggcggggtgaagaagccccat cgctacaggcctgggaccgttgcacttcgagaaatctgttgttaccagaaatccaccgag cttctgatcctgaagctgcctttccagaggttggtgagggagatcgcccaggatttcaga accgacctgaggtttcagagtgcagccattggtgcgctgcaggaggctagcgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacaaggagagaaagcttaa

DBGET integrated database retrieval system