Myotis brandtii (Brandt's bat): 102246392 Help Entry 102246392         CDS       T02920                                  Symbol CLDN1, Claudin-1 Name (RefSeq) claudin 1   KO K06087   claudin Organism myb  Myotis brandtii (Brandt's bat) Pathway myb03272   Virion - Hepatitis viruses myb04382   Cornified envelope formation myb04514   Cell adhesion molecule (CAM) interaction myb04530   Tight junction myb04670   Leukocyte transendothelial migration myb05160   Hepatitis C Brite KEGG Orthology (KO) [BR:myb00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102246392 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     102246392 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102246392 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102246392 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     102246392 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102246392 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:myb03037]     102246392 (CLDN1)    04147 Exosome [BR:myb04147]     102246392 (CLDN1) Cilium and associated proteins [BR:myb03037]  Other cilia and associated proteins   Stereociliary proteins    102246392 (CLDN1) Exosome [BR:myb04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102246392 (CLDN1)   Exosomal proteins of colorectal cancer cells    102246392 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Cytochrom_B_C Clc-like SUR7 OppC_N DUF6594 DUF6479 CD20 Motif Other DBs NCBI-GeneID:  102246392 NCBI-ProteinID:  XP_005880827 UniProt:  S7Q7B2 LinkDB All DBs Position Un AA seq 210 aa AA seqDB search MANAGLQLLGFILAFVGWIGAIASTAMPQWKVHSYAGDNIVTAQSIYEGLWMSCVSQSTG QIQCKVYDSLLNLNSTLQATRALMVVCILLGLIAIFVATVGMKCMKCLEDDEVQKMRMAV IGGVIFLIAGLAALVATAWYGHRIVQEFYDPLTPVNARYEFGAALFTGWAAASLCLLGGA LLCCSCPRKTSYPTPRPYPKPAPSSGKDYV NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcggggctgcaactgctgggcttcatcctggccttcgtgggctggattgga gccatcgccagcactgcgatgccccagtggaaggttcactcctatgcgggcgacaacatc gtgacagcccagtccatctacgaggggctgtggatgtcctgcgtgtcgcagagtaccggg cagatccagtgcaaagtctacgactccttgctgaacctgaacagcactttgcaagcaacc cgtgccttgatggtggtttgcatcctgctgggactaatagctatctttgtggccactgtt ggcatgaagtgtatgaagtgcctggaggatgatgaggtccagaagatgcggatggctgtc attggaggcgtgatatttcttattgcaggtctagctgctttagttgccacagcatggtat ggccacagaattgttcaagaattctatgaccccctgacaccagtcaatgccaggtatgaa tttggtgcggctctcttcactggctgggctgctgcttctctctgccttctgggaggtgcc ctactttgctgctcctgcccccgaaaaacatcttacccaacaccacggccctatcccaag cctgcaccttccagtgggaaagactacgtgtga

DBGET integrated database retrieval system