Myotis brandtii (Brandt's bat): 102246598 Help Entry 102246598         CDS       T02920                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04060   Cytokine-cytokine receptor interaction myb04061   Viral protein interaction with cytokine and cytokine receptor myb04062   Chemokine signaling pathway myb04620   Toll-like receptor signaling pathway myb05142   Chagas disease myb05163   Human cytomegalovirus infection myb05323   Rheumatoid arthritis myb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102246598    04061 Viral protein interaction with cytokine and cytokine receptor     102246598  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102246598    04062 Chemokine signaling pathway     102246598  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102246598   09174 Infectious disease: parasitic    05142 Chagas disease     102246598   09163 Immune disease    05323 Rheumatoid arthritis     102246598   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102246598  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myb04052]     102246598    00536 Glycosaminoglycan binding proteins [BR:myb00536]     102246598 Cytokines and neuropeptides [BR:myb04052]  Cytokines   Chemokines    102246598 Glycosaminoglycan binding proteins [BR:myb00536]  Heparan sulfate / Heparin   Chemokines    102246598 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102246598 NCBI-ProteinID:  XP_005860280 LinkDB All DBs Position Un AA seq 93 aa AA seqDB search MKVSGAALAVLLCTMALCSQVLSAPVGADTPTACCFTYAPRQIPRTYIVDYFETSSQCSK PGVIFQTRRGRQVCANPNEDWVQEYVADLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccggggctgccctggccgtcctcctctgcaccatggccctctgcagccag gtcttgtctgcaccagttggtgctgacaccccgaccgcctgctgcttcacctatgcgcct cggcagattccacgtacatacatcgtcgactattttgagaccagcagccagtgttccaag cctggtgtcatcttccaaaccagaagaggccggcaagtctgtgccaaccccaatgaggac tgggtccaggaatacgtcgccgacctggagctgaacgcctga

DBGET integrated database retrieval system