Myotis brandtii (Brandt's bat): 102246905 Help Entry 102246905         CDS       T02920                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04814   Motor proteins myb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:myb00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102246905  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102246905  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:myb03037]     102246905    04812 Cytoskeleton proteins [BR:myb04812]     102246905 Cilium and associated proteins [BR:myb03037]  Motile cilia and associated proteins   Dynein arm    102246905 Cytoskeleton proteins [BR:myb04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102246905 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  102246905 NCBI-ProteinID:  XP_005860742 UniProt:  S7P298 LinkDB All DBs Position Un AA seq 115 aa AA seqDB search MEDYQTAEETTFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCIIMQKNGAGLHTASSCFWDSSTDGTVLSPWVRVCRGHFPEVVVSSWTC NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccagactgcggaagagaccacttttgttgttgacgaagtgagcaacatt gtgaaagaggctatagaaagtgccatcggtggcaacgcctatcagcacagcaaagtcaat cagtggaccacaaatgtcgtagaacaaactttaagccaactcaccaagctgggaaaacca ttcaaatacattgtgacctgtataattatgcagaagaacggagcaggactacacacggcg agttcttgcttctgggacagctctactgacggtacggttctcagtccctgggtcagagtc tgtcgtgggcattttcctgaggtggtggtgtcttcttggacctgctga

DBGET integrated database retrieval system