Myotis brandtii (Brandt's bat): 102247655 Help Entry 102247655         CDS       T02920                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04613   Neutrophil extracellular trap formation myb05034   Alcoholism myb05203   Viral carcinogenesis myb05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:myb00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102247655  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102247655   09163 Immune disease    05322 Systemic lupus erythematosus     102247655   09165 Substance dependence    05034 Alcoholism     102247655  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:myb03036]     102247655   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myb04147]     102247655 Chromosome and associated proteins [BR:myb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102247655 Exosome [BR:myb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102247655 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  102247655 NCBI-ProteinID:  XP_014397407 UniProt:  S7PD05 LinkDB All DBs Position Un AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggaaccagcgaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgcgagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtag

DBGET integrated database retrieval system