Myotis brandtii (Brandt's bat): 102248499 Help Entry 102248499         CDS       T02920                                  Symbol PFN1, Profilin-1 Name (RefSeq) profilin 1   KO K05759   profilin Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04015   Rap1 signaling pathway myb04810   Regulation of actin cytoskeleton myb05014   Amyotrophic lateral sclerosis myb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102248499 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102248499 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102248499 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102248499 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myb04131]     102248499 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:myb04812]     102248499 (PFN1)    04147 Exosome [BR:myb04147]     102248499 (PFN1) Membrane trafficking [BR:myb04131]  Others   Actin-binding proteins    Others     102248499 (PFN1) Cytoskeleton proteins [BR:myb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102248499 (PFN1) Exosome [BR:myb04147]  Exosomal proteins   Proteins found in most exosomes    102248499 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102248499 NCBI-ProteinID:  XP_005882652 UniProt:  S7NKD6 LinkDB All DBs Position Un AA seq 129 aa AA seqDB search MADGTCQDAAIVGYKDTPSIWAAVPGKAFANITPAEVGVLVGKDRASLCVNGLTIGGQKC SVIRDTLLQEGEFSMDLRTKSTGGAPTFNVTVAMTAKTLVLLMGKEGIHGGVINKKCYEM ANHLRRSQY NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggcggacgggacctgtcaggacgcggccatcgtgggctataaggacacgccctccatc tgggccgctgttcccgggaaagccttcgccaacatcacgccagctgaagttggtgtcctg gttggcaaagaccgggcaagtctgtgcgtgaatgggctgacaatcgggggccagaaatgt tctgtgatccgggacacgctgctgcaggaaggggagtttagcatggatcttcgtaccaag agcactgggggagcccccaccttcaacgtcactgtcgccatgactgccaagacgctagtc ctgctgatgggcaaagaaggtatccacggtggtgtgatcaacaagaaatgttatgaaatg gccaaccacctgcggcgttcccagtactga

DBGET integrated database retrieval system