Myotis brandtii (Brandt's bat): 102250437 Help Entry 102250437         CDS       T02920                                  Symbol UBB Name (RefSeq) ubiquitin B   KO K04551   ubiquitin B Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04120   Ubiquitin mediated proteolysis myb04137   Mitophagy - animal myb04140   Autophagy - animal myb05012   Parkinson disease myb05022   Pathways of neurodegeneration - multiple diseases myb05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:myb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102250437 (UBB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102250437 (UBB)    04137 Mitophagy - animal     102250437 (UBB)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     102250437 (UBB)   09164 Neurodegenerative disease    05012 Parkinson disease     102250437 (UBB)    05022 Pathways of neurodegeneration - multiple diseases     102250437 (UBB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:myb04121]     102250437 (UBB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myb04147]     102250437 (UBB) Ubiquitin system [BR:myb04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    102250437 (UBB) Exosome [BR:myb04147]  Exosomal proteins   Exosomal proteins of breast milk    102250437 (UBB)   Exosomal proteins of other body fluids (saliva and urine)    102250437 (UBB)   Exosomal proteins of colorectal cancer cells    102250437 (UBB)   Exosomal proteins of bladder cancer cells    102250437 (UBB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 OTU1_UBXL DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 UBL_UBAC1 Dsc3_N Motif Other DBs NCBI-GeneID:  102250437 NCBI-ProteinID:  XP_005870266 LinkDB All DBs Position Un AA seq 148 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIEDVKPRSRIRKASPLTSRGSS LLASSWKMAALFLTTTSRKSPPCTWSSV NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgcaaatcttcgtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagt gacaccattgagaatgttaaagccaagatccaggataaggaaggcatcccccctgaccag cagaggctcatctttgctggcaagcagctggaagatggccgcactctttctgactacaac atccagaaagagtccaccctgcacctggtcctgcgtctgaggggtggtatgcagatcttc gtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagtgacaccattgag gatgtaaagccaagatccaggataaggaaggcatcccccctgaccagcagaggctcatct ttgctggcaagcagctggaagatggccgcactctttctgactacaacatccagaaagagt ccaccctgcacctggtcctccgtctga

DBGET integrated database retrieval system