Myotis brandtii (Brandt's bat): 102250449 Help Entry 102250449         CDS       T02920                                  Symbol CCL17 Name (RefSeq) C-C motif chemokine ligand 17   KO K21083   C-C motif chemokine 17 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04060   Cytokine-cytokine receptor interaction myb04061   Viral protein interaction with cytokine and cytokine receptor myb04062   Chemokine signaling pathway myb04625   C-type lectin receptor signaling pathway myb04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102250449 (CCL17)    04061 Viral protein interaction with cytokine and cytokine receptor     102250449 (CCL17)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102250449 (CCL17)    04657 IL-17 signaling pathway     102250449 (CCL17)    04062 Chemokine signaling pathway     102250449 (CCL17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myb04052]     102250449 (CCL17) Cytokines and neuropeptides [BR:myb04052]  Cytokines   Chemokines    102250449 (CCL17) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102250449 NCBI-ProteinID:  XP_005873614 UniProt:  S7N5K3 LinkDB All DBs Position Un AA seq 63 aa AA seqDB search MTPWKTLLLLTLLLGASLQEARAARGINVGRECCVEYFKGAIPVRRVVRWYQTSEECPRA AVV NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgaccccatggaagacgctgctcctgctcaccctcctcctgggggcttccctgcaggag gcccgtgcagctcgagggatcaacgtgggccgggagtgctgcgtggagtacttcaaaggg gccatccctgtgcggagggtggtgcggtggtaccagacctcggaggagtgtcccagggct gctgtcgtgtaa

DBGET integrated database retrieval system