Myotis brandtii (Brandt's bat): 102251877 Help Entry 102251877         CDS       T02920                                  Symbol IL1A Name (RefSeq) interleukin 1 alpha   KO K04383   interleukin 1 alpha Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04010   MAPK signaling pathway myb04060   Cytokine-cytokine receptor interaction myb04217   Necroptosis myb04218   Cellular senescence myb04380   Osteoclast differentiation myb04640   Hematopoietic cell lineage myb04932   Non-alcoholic fatty liver disease myb04933   AGE-RAGE signaling pathway in diabetic complications myb04940   Type I diabetes mellitus myb05010   Alzheimer disease myb05020   Prion disease myb05022   Pathways of neurodegeneration - multiple diseases myb05133   Pertussis myb05140   Leishmaniasis myb05152   Tuberculosis myb05162   Measles myb05164   Influenza A myb05321   Inflammatory bowel disease myb05323   Rheumatoid arthritis myb05332   Graft-versus-host disease myb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102251877 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102251877 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102251877 (IL1A)    04218 Cellular senescence     102251877 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102251877 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     102251877 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102251877 (IL1A)    05162 Measles     102251877 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     102251877 (IL1A)    05152 Tuberculosis     102251877 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102251877 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     102251877 (IL1A)    05321 Inflammatory bowel disease     102251877 (IL1A)    05332 Graft-versus-host disease     102251877 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     102251877 (IL1A)    05020 Prion disease     102251877 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     102251877 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102251877 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102251877 (IL1A)    04932 Non-alcoholic fatty liver disease     102251877 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     102251877 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myb04052]     102251877 (IL1A) Cytokines and neuropeptides [BR:myb04052]  Cytokines   Interleukins    102251877 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 CPV_RdRP_C Motif Other DBs NCBI-GeneID:  102251877 NCBI-ProteinID:  XP_005881876 LinkDB All DBs Position Un AA seq 269 aa AA seqDB search MAQVPDLFEDLKSCYSENEEYSSEIDQLSLSQKSFYDASYDPLPKNCMGQFLSLSTAGTS KTSQLTYKESVVVVAANGKILKKRRLSFNQFITNDDVETIANDPEEEILQPTSVPYSLQG NVKYPFMMVIKRHFILNDNLHQSIIRDTSGHFLMAAALNNMEQAVRFDMDAYKSDDLKLP VTLRISDTRLFLSAQNEGESVLLKELPETPKIITDETNLLFFWEHRGNKDYFESVAHPKL FIATKQEYQVHMASGHPSIIDLQILENYP NT seq 810 nt NT seq  +upstreamnt  +downstreamnt atggctcaggtccctgacctctttgaagacctgaagagctgctacagtgaaaatgaagaa tacagttctgaaattgaccaactctctctgagtcagaaatccttctatgatgcaagctac gacccacttcccaagaactgcatgggccaattcctatctctgagtaccgctgggacctct aagacatcccagcttacctacaaggagagtgtggtggtggtggcggccaatgggaagatt ctgaagaagagacggttgagtttcaatcagttcattaccaatgatgacgtggaaaccatt gccaatgatccagaagaagaaatcctccagcccacgtcagtaccttacagcctccagggc aacgtgaagtaccccttcatgatggtcatcaaaaggcatttcatcctgaatgacaacctc catcaaagtatcattcgagacacatcgggtcacttcctcatggccgccgcattaaataat atggaacaagcagtgagatttgacatggatgcttataagtcagatgaccttaaacttcct gtgactctgagaatctcagacacgcgactgtttctgagtgcacaaaatgaaggcgaatcc gtattgctaaaggagttgcctgagacacccaaaatcatcacagatgagaccaacctcctc ttcttctgggaacatcggggcaataaggactactttgagtcagttgcccatccaaagctg tttattgccacaaagcaagaataccaggtgcacatggcaagtgggcatccctctatcatt gacttgcagatactggaaaactacccttaa

DBGET integrated database retrieval system