Myotis brandtii (Brandt's bat): 102254975 Help Entry 102254975         CDS       T02920                                  Symbol PFN3, Profilin-3 Name (RefSeq) profilin 3   KO K05759   profilin Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04015   Rap1 signaling pathway myb04810   Regulation of actin cytoskeleton myb05014   Amyotrophic lateral sclerosis myb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102254975 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102254975 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102254975 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102254975 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myb04131]     102254975 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:myb04812]     102254975 (PFN3)    04147 Exosome [BR:myb04147]     102254975 (PFN3) Membrane trafficking [BR:myb04131]  Others   Actin-binding proteins    Others     102254975 (PFN3) Cytoskeleton proteins [BR:myb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102254975 (PFN3) Exosome [BR:myb04147]  Exosomal proteins   Proteins found in most exosomes    102254975 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102254975 NCBI-ProteinID:  XP_005865552 UniProt:  S7PGQ0 LinkDB All DBs Position Un AA seq 137 aa AA seqDB search MGEWKAYISAVLQDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGQDRCTFL QAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKKVHELIHWLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgagtggaaagcctacatcagtgcggtgctgcaggaccagcgcatcgacgacgta gccatcgtgggccactcggacaatcgctgtgtgtgggcatcgcggcccgggggactgctg gccgccatctcgccgcaggaggtgggtgtgctcacggggcaggaccggtgcaccttcctg caggccggcctgagcgtggcgggccgccgctgctgcgtcatcagagaccacctgctggcg gagggcgacggcgtgctggacgcgcgcaccaaggggctggatgggcgcgcggtctgcgtg ggccacacgccgcgcgcgcttctggtgctcatgggccggcggggcgtgcacgggggcatc ctcaacaagaaggtgcacgagctgatccactggctgcgcactcagggcacctag

DBGET integrated database retrieval system