KEGG   Myotis brandtii (Brandt's bat): 102255250
Entry
102255250         CDS       T02920                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01521  EGFR tyrosine kinase inhibitor resistance
myb01522  Endocrine resistance
myb01524  Platinum drug resistance
myb04010  MAPK signaling pathway
myb04012  ErbB signaling pathway
myb04014  Ras signaling pathway
myb04015  Rap1 signaling pathway
myb04022  cGMP-PKG signaling pathway
myb04024  cAMP signaling pathway
myb04062  Chemokine signaling pathway
myb04066  HIF-1 signaling pathway
myb04068  FoxO signaling pathway
myb04071  Sphingolipid signaling pathway
myb04072  Phospholipase D signaling pathway
myb04114  Oocyte meiosis
myb04140  Autophagy - animal
myb04148  Efferocytosis
myb04150  mTOR signaling pathway
myb04151  PI3K-Akt signaling pathway
myb04210  Apoptosis
myb04218  Cellular senescence
myb04261  Adrenergic signaling in cardiomyocytes
myb04270  Vascular smooth muscle contraction
myb04350  TGF-beta signaling pathway
myb04360  Axon guidance
myb04370  VEGF signaling pathway
myb04371  Apelin signaling pathway
myb04380  Osteoclast differentiation
myb04510  Focal adhesion
myb04517  IgSF CAM signaling
myb04520  Adherens junction
myb04540  Gap junction
myb04550  Signaling pathways regulating pluripotency of stem cells
myb04611  Platelet activation
myb04613  Neutrophil extracellular trap formation
myb04620  Toll-like receptor signaling pathway
myb04621  NOD-like receptor signaling pathway
myb04625  C-type lectin receptor signaling pathway
myb04650  Natural killer cell mediated cytotoxicity
myb04657  IL-17 signaling pathway
myb04658  Th1 and Th2 cell differentiation
myb04659  Th17 cell differentiation
myb04660  T cell receptor signaling pathway
myb04662  B cell receptor signaling pathway
myb04664  Fc epsilon RI signaling pathway
myb04666  Fc gamma R-mediated phagocytosis
myb04668  TNF signaling pathway
myb04713  Circadian entrainment
myb04720  Long-term potentiation
myb04722  Neurotrophin signaling pathway
myb04723  Retrograde endocannabinoid signaling
myb04724  Glutamatergic synapse
myb04725  Cholinergic synapse
myb04726  Serotonergic synapse
myb04730  Long-term depression
myb04810  Regulation of actin cytoskeleton
myb04910  Insulin signaling pathway
myb04912  GnRH signaling pathway
myb04914  Progesterone-mediated oocyte maturation
myb04915  Estrogen signaling pathway
myb04916  Melanogenesis
myb04917  Prolactin signaling pathway
myb04919  Thyroid hormone signaling pathway
myb04921  Oxytocin signaling pathway
myb04926  Relaxin signaling pathway
myb04928  Parathyroid hormone synthesis, secretion and action
myb04929  GnRH secretion
myb04930  Type II diabetes mellitus
myb04933  AGE-RAGE signaling pathway in diabetic complications
myb04934  Cushing syndrome
myb04935  Growth hormone synthesis, secretion and action
myb04960  Aldosterone-regulated sodium reabsorption
myb05010  Alzheimer disease
myb05020  Prion disease
myb05022  Pathways of neurodegeneration - multiple diseases
myb05034  Alcoholism
myb05132  Salmonella infection
myb05133  Pertussis
myb05135  Yersinia infection
myb05140  Leishmaniasis
myb05142  Chagas disease
myb05145  Toxoplasmosis
myb05152  Tuberculosis
myb05160  Hepatitis C
myb05161  Hepatitis B
myb05163  Human cytomegalovirus infection
myb05164  Influenza A
myb05165  Human papillomavirus infection
myb05166  Human T-cell leukemia virus 1 infection
myb05167  Kaposi sarcoma-associated herpesvirus infection
myb05170  Human immunodeficiency virus 1 infection
myb05171  Coronavirus disease - COVID-19
myb05200  Pathways in cancer
myb05203  Viral carcinogenesis
myb05205  Proteoglycans in cancer
myb05206  MicroRNAs in cancer
myb05207  Chemical carcinogenesis - receptor activation
myb05208  Chemical carcinogenesis - reactive oxygen species
myb05210  Colorectal cancer
myb05211  Renal cell carcinoma
myb05212  Pancreatic cancer
myb05213  Endometrial cancer
myb05214  Glioma
myb05215  Prostate cancer
myb05216  Thyroid cancer
myb05218  Melanoma
myb05219  Bladder cancer
myb05220  Chronic myeloid leukemia
myb05221  Acute myeloid leukemia
myb05223  Non-small cell lung cancer
myb05224  Breast cancer
myb05225  Hepatocellular carcinoma
myb05226  Gastric cancer
myb05230  Central carbon metabolism in cancer
myb05231  Choline metabolism in cancer
myb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
myb05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102255250 (MAPK3)
   04012 ErbB signaling pathway
    102255250 (MAPK3)
   04014 Ras signaling pathway
    102255250 (MAPK3)
   04015 Rap1 signaling pathway
    102255250 (MAPK3)
   04350 TGF-beta signaling pathway
    102255250 (MAPK3)
   04370 VEGF signaling pathway
    102255250 (MAPK3)
   04371 Apelin signaling pathway
    102255250 (MAPK3)
   04668 TNF signaling pathway
    102255250 (MAPK3)
   04066 HIF-1 signaling pathway
    102255250 (MAPK3)
   04068 FoxO signaling pathway
    102255250 (MAPK3)
   04072 Phospholipase D signaling pathway
    102255250 (MAPK3)
   04071 Sphingolipid signaling pathway
    102255250 (MAPK3)
   04024 cAMP signaling pathway
    102255250 (MAPK3)
   04022 cGMP-PKG signaling pathway
    102255250 (MAPK3)
   04151 PI3K-Akt signaling pathway
    102255250 (MAPK3)
   04150 mTOR signaling pathway
    102255250 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102255250 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102255250 (MAPK3)
   04148 Efferocytosis
    102255250 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102255250 (MAPK3)
   04210 Apoptosis
    102255250 (MAPK3)
   04218 Cellular senescence
    102255250 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102255250 (MAPK3)
   04520 Adherens junction
    102255250 (MAPK3)
   04540 Gap junction
    102255250 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102255250 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102255250 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102255250 (MAPK3)
   04613 Neutrophil extracellular trap formation
    102255250 (MAPK3)
   04620 Toll-like receptor signaling pathway
    102255250 (MAPK3)
   04621 NOD-like receptor signaling pathway
    102255250 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    102255250 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    102255250 (MAPK3)
   04660 T cell receptor signaling pathway
    102255250 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    102255250 (MAPK3)
   04659 Th17 cell differentiation
    102255250 (MAPK3)
   04657 IL-17 signaling pathway
    102255250 (MAPK3)
   04662 B cell receptor signaling pathway
    102255250 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    102255250 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    102255250 (MAPK3)
   04062 Chemokine signaling pathway
    102255250 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102255250 (MAPK3)
   04929 GnRH secretion
    102255250 (MAPK3)
   04912 GnRH signaling pathway
    102255250 (MAPK3)
   04915 Estrogen signaling pathway
    102255250 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    102255250 (MAPK3)
   04917 Prolactin signaling pathway
    102255250 (MAPK3)
   04921 Oxytocin signaling pathway
    102255250 (MAPK3)
   04926 Relaxin signaling pathway
    102255250 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    102255250 (MAPK3)
   04919 Thyroid hormone signaling pathway
    102255250 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    102255250 (MAPK3)
   04916 Melanogenesis
    102255250 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102255250 (MAPK3)
   04270 Vascular smooth muscle contraction
    102255250 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102255250 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102255250 (MAPK3)
   04725 Cholinergic synapse
    102255250 (MAPK3)
   04726 Serotonergic synapse
    102255250 (MAPK3)
   04720 Long-term potentiation
    102255250 (MAPK3)
   04730 Long-term depression
    102255250 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    102255250 (MAPK3)
   04722 Neurotrophin signaling pathway
    102255250 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    102255250 (MAPK3)
   04380 Osteoclast differentiation
    102255250 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102255250 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102255250 (MAPK3)
   05206 MicroRNAs in cancer
    102255250 (MAPK3)
   05205 Proteoglycans in cancer
    102255250 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    102255250 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    102255250 (MAPK3)
   05203 Viral carcinogenesis
    102255250 (MAPK3)
   05230 Central carbon metabolism in cancer
    102255250 (MAPK3)
   05231 Choline metabolism in cancer
    102255250 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102255250 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102255250 (MAPK3)
   05212 Pancreatic cancer
    102255250 (MAPK3)
   05225 Hepatocellular carcinoma
    102255250 (MAPK3)
   05226 Gastric cancer
    102255250 (MAPK3)
   05214 Glioma
    102255250 (MAPK3)
   05216 Thyroid cancer
    102255250 (MAPK3)
   05221 Acute myeloid leukemia
    102255250 (MAPK3)
   05220 Chronic myeloid leukemia
    102255250 (MAPK3)
   05218 Melanoma
    102255250 (MAPK3)
   05211 Renal cell carcinoma
    102255250 (MAPK3)
   05219 Bladder cancer
    102255250 (MAPK3)
   05215 Prostate cancer
    102255250 (MAPK3)
   05213 Endometrial cancer
    102255250 (MAPK3)
   05224 Breast cancer
    102255250 (MAPK3)
   05223 Non-small cell lung cancer
    102255250 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102255250 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    102255250 (MAPK3)
   05161 Hepatitis B
    102255250 (MAPK3)
   05160 Hepatitis C
    102255250 (MAPK3)
   05171 Coronavirus disease - COVID-19
    102255250 (MAPK3)
   05164 Influenza A
    102255250 (MAPK3)
   05163 Human cytomegalovirus infection
    102255250 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102255250 (MAPK3)
   05165 Human papillomavirus infection
    102255250 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102255250 (MAPK3)
   05135 Yersinia infection
    102255250 (MAPK3)
   05133 Pertussis
    102255250 (MAPK3)
   05152 Tuberculosis
    102255250 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102255250 (MAPK3)
   05140 Leishmaniasis
    102255250 (MAPK3)
   05142 Chagas disease
    102255250 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102255250 (MAPK3)
   05020 Prion disease
    102255250 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    102255250 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    102255250 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102255250 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102255250 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102255250 (MAPK3)
   04934 Cushing syndrome
    102255250 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102255250 (MAPK3)
   01524 Platinum drug resistance
    102255250 (MAPK3)
   01522 Endocrine resistance
    102255250 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myb01001]
    102255250 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myb03036]
    102255250 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myb04147]
    102255250 (MAPK3)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102255250 (MAPK3)
Protein kinases [BR:myb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102255250 (MAPK3)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102255250 (MAPK3)
Exosome [BR:myb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102255250 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 102255250
NCBI-ProteinID: XP_005882041
UniProt: S7NJF5
LinkDB
Position
Un
AA seq 467 aa
MGNSSAALTALPASCLPPAPVTPSFSRYLPHCLPCTRLPAPDLSRLREPIAGRGRAARRE
RAAERGSLSGRSSSLCEVTEGLPGRSPAFSLESAGLRSRKEPALFTTWPEPTRLPPFPAT
AWVGPAGLDSPYVGPHQHHLSGPLSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQIL
LRFRHENVISIRDILRAPTLDAMRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILR
GLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRA
PEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCI
INMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQ
YYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGVLEAT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggggaacagctctgctgccctgacagccctgcctgcctcatgcctccctccagccccc
gtgactccctccttctcccggtatttgcctcactgtctgccctgcactcgtctcccagcc
cccgacctgtccaggctgcgggagcccatcgcggggcggggcagggcagctcgaagggag
cgggctgcagagaggggaagtctgagcggccgctcttcctctctttgtgaagtcaccgaa
gggctgcctggccggtccccagctttctccctggagagcgcaggccttcgcagcaggaag
gaaccagcattgtttacgacttggccagagcccactcggctccctcccttcccggccacg
gcctgggtggggccagctggcctggactccccctatgtaggaccacaccaacaccacctc
tctggccctctcagctcagcttacgaccacgtccgcaagacacgcgtggccatcaagaaa
atcagccccttcgagcaccagacctactgccagcgcacgctgcgggaaatccagatcttg
ctgcgcttccgccacgagaatgtcatcagcatccgagacattcttcgggcacctaccctg
gatgccatgagggatgtctacattgtgcaggacctgatggagacagacctgtacaagttg
ctcaaaagccagcagctgagcaacgaccacgtctgctacttcctctaccagatcctgcgg
ggcctcaagtatatccactcagctaacgtgctccaccgggatttaaagccctccaacctg
ctcatcaacaccacctgcgaccttaagatctgcgattttggcctggcccggatcgccgat
cccgagcatgaccacacgggcttcctgacagaatacgtggccacgcgctggtaccgggcc
ccagagatcatgctgaactccaagggctacaccaagtccatcgatatctggtctgtgggc
tgcattctggctgaaatgctctccaaccggcccatcttccctggcaagcactacctggac
cagctcaaccacattctgggcatcctgggttccccatcccaagaggacctgaattgtatc
atcaacatgaaggcccggaactacctgcagtctctgccttccaagaccaaggtggcctgg
gccaagctcttccccaagtcagactccaaagcccttgacctgctggaccggatgttgacc
tttaaccctaataaacggatcacagtagaagaagccctggctcacccctacctggagcag
tactacgacccaacagatgagccagtggccgaggaacctttcacctttgacatggagctg
gatgatctacccaaggagcggctgaaggagctcatattccaggagacagcccgcttccag
cctggggtgctggaggccacctaa

DBGET integrated database retrieval system