Myotis brandtii (Brandt's bat): 102256861 Help Entry 102256861         CDS       T02920                                  Symbol CD247 Name (RefSeq) CD247 molecule   KO K06453   CD3Z antigen, zeta polypeptide Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04650   Natural killer cell mediated cytotoxicity myb04658   Th1 and Th2 cell differentiation myb04659   Th17 cell differentiation myb04660   T cell receptor signaling pathway myb05142   Chagas disease myb05169   Epstein-Barr virus infection myb05170   Human immunodeficiency virus 1 infection myb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:myb00001]  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     102256861 (CD247)    04660 T cell receptor signaling pathway     102256861 (CD247)    04658 Th1 and Th2 cell differentiation     102256861 (CD247)    04659 Th17 cell differentiation     102256861 (CD247)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102256861 (CD247)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102256861 (CD247)    05169 Epstein-Barr virus infection     102256861 (CD247)   09174 Infectious disease: parasitic    05142 Chagas disease     102256861 (CD247)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myb04147]     102256861 (CD247)    04090 CD molecules [BR:myb04090]     102256861 (CD247) Exosome [BR:myb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102256861 (CD247) CD molecules [BR:myb04090]  Proteins   102256861 (CD247) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TCR_zetazeta ITAM Motif Other DBs NCBI-GeneID:  102256861 NCBI-ProteinID:  XP_014384013 LinkDB All DBs Position Un AA seq 151 aa AA seqDB search MKWEALVIAAVLQAQFPVTEAQSFGLLDPKLCYLLDGILFIYGIIITALFLRAKFSGSAD APEHLQGPNQVYNELNLGRREEYDLLDKRRGRDPEMGGKQRRKNPQEGLYNALQREKMAE AYSEIGTKGDGLSTATKDTYDALHMQALPPR NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgaagtgggaggcgcttgtcatcgcggccgtcctgcaggcccagttcccagtgacagag gcacagagcttcggcctgctggaccccaagctctgctacctgctggatgggatcctgttc atctatggcatcatcatcaccgccctgttcctgagagcgaagttcagcgggagtgcagac gccccggagcacctgcagggccccaaccaggtctacaacgagctcaacctggggaggaga gaggagtatgaccttctggataagagacggggccgagaccctgagatgggcggaaagcag aggaggaagaacccccaggagggcctgtacaacgcgctgcagagggagaagatggcagag gcctacagcgagatcgggacgaaaggcgatgggctcagtacggccaccaaagacacctat gacgccctccacatgcaggcgctgccccctcgctag

DBGET integrated database retrieval system