KEGG   Myotis brandtii (Brandt's bat): 102256865
Entry
102256865         CDS       T02920                                 
Name
(RefSeq) calmodulin
  KO
K02183  calmodulin
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04014  Ras signaling pathway
myb04015  Rap1 signaling pathway
myb04020  Calcium signaling pathway
myb04022  cGMP-PKG signaling pathway
myb04024  cAMP signaling pathway
myb04070  Phosphatidylinositol signaling system
myb04114  Oocyte meiosis
myb04218  Cellular senescence
myb04261  Adrenergic signaling in cardiomyocytes
myb04270  Vascular smooth muscle contraction
myb04371  Apelin signaling pathway
myb04625  C-type lectin receptor signaling pathway
myb04713  Circadian entrainment
myb04720  Long-term potentiation
myb04722  Neurotrophin signaling pathway
myb04728  Dopaminergic synapse
myb04740  Olfactory transduction
myb04744  Phototransduction
myb04750  Inflammatory mediator regulation of TRP channels
myb04910  Insulin signaling pathway
myb04912  GnRH signaling pathway
myb04915  Estrogen signaling pathway
myb04916  Melanogenesis
myb04921  Oxytocin signaling pathway
myb04922  Glucagon signaling pathway
myb04924  Renin secretion
myb04925  Aldosterone synthesis and secretion
myb04970  Salivary secretion
myb04971  Gastric acid secretion
myb05010  Alzheimer disease
myb05012  Parkinson disease
myb05022  Pathways of neurodegeneration - multiple diseases
myb05031  Amphetamine addiction
myb05034  Alcoholism
myb05133  Pertussis
myb05152  Tuberculosis
myb05163  Human cytomegalovirus infection
myb05167  Kaposi sarcoma-associated herpesvirus infection
myb05170  Human immunodeficiency virus 1 infection
myb05200  Pathways in cancer
myb05214  Glioma
myb05417  Lipid and atherosclerosis
myb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102256865
   04015 Rap1 signaling pathway
    102256865
   04371 Apelin signaling pathway
    102256865
   04020 Calcium signaling pathway
    102256865
   04070 Phosphatidylinositol signaling system
    102256865
   04024 cAMP signaling pathway
    102256865
   04022 cGMP-PKG signaling pathway
    102256865
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102256865
   04218 Cellular senescence
    102256865
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102256865
  09152 Endocrine system
   04910 Insulin signaling pathway
    102256865
   04922 Glucagon signaling pathway
    102256865
   04912 GnRH signaling pathway
    102256865
   04915 Estrogen signaling pathway
    102256865
   04921 Oxytocin signaling pathway
    102256865
   04916 Melanogenesis
    102256865
   04924 Renin secretion
    102256865
   04925 Aldosterone synthesis and secretion
    102256865
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102256865
   04270 Vascular smooth muscle contraction
    102256865
  09154 Digestive system
   04970 Salivary secretion
    102256865
   04971 Gastric acid secretion
    102256865
  09156 Nervous system
   04728 Dopaminergic synapse
    102256865
   04720 Long-term potentiation
    102256865
   04722 Neurotrophin signaling pathway
    102256865
  09157 Sensory system
   04744 Phototransduction
    102256865
   04740 Olfactory transduction
    102256865
   04750 Inflammatory mediator regulation of TRP channels
    102256865
  09159 Environmental adaptation
   04713 Circadian entrainment
    102256865
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102256865
  09162 Cancer: specific types
   05214 Glioma
    102256865
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102256865
   05163 Human cytomegalovirus infection
    102256865
   05167 Kaposi sarcoma-associated herpesvirus infection
    102256865
  09171 Infectious disease: bacterial
   05133 Pertussis
    102256865
   05152 Tuberculosis
    102256865
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102256865
   05012 Parkinson disease
    102256865
   05022 Pathways of neurodegeneration - multiple diseases
    102256865
  09165 Substance dependence
   05031 Amphetamine addiction
    102256865
   05034 Alcoholism
    102256865
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102256865
   05418 Fluid shear stress and atherosclerosis
    102256865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:myb01009]
    102256865
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:myb04131]
    102256865
   03036 Chromosome and associated proteins [BR:myb03036]
    102256865
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myb04147]
    102256865
Protein phosphatases and associated proteins [BR:myb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102256865
Membrane trafficking [BR:myb04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102256865
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     102256865
Exosome [BR:myb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102256865
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF-hand_11 EF_EFCAB10_C PrkA DUF5580_M DUF1103 Dockerin_1 EFhand_Ca_insen Poly_export
Other DBs
NCBI-GeneID: 102256865
NCBI-ProteinID: XP_014391355
LinkDB
Position
Un
AA seq 139 aa
MRSLGQNPTEAELQGMINEVDADGNGTIDLPEFLTMMARKMKDTDIEEEIREAFRVFDKD
GNGYISAAELRPVMTNLGEMLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKWGYCTEC
VKFLVQNCSFAFSLFVTCL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgaggtctcttgggcagaatcccacagaagcagagttacagggcatgataaatgaagtg
gatgctgatggtaatggcacaatcgacctcccagaatttctgacaatgatggcaagaaaa
atgaaagacacagacattgaagaagaaattcgagaagcattccgggtgtttgataaggat
ggcaatggctatattagtgcagcagagcttcgccctgtgatgacaaaccttggagagatg
ttaacagatgaagaggttgatgaaatgatcagggaagcagatattgatggtgatggtcaa
gtaaactatgaagagtttgtacaaatgatgacggcaaagtggggatattgtacagaatgt
gttaaatttcttgtacaaaattgttcatttgccttttctttgtttgtaacttgtctgtaa

DBGET integrated database retrieval system